************************************************************************
********** REPORT OF PROTEIN ANALYSIS  by the WHAT IF program **********
************************************************************************

Date : 2024-03-26
This report was created by WHAT IF version WHATCHECK15.0

This document is a WHAT_CHECK 14.0 report for a PDB-file. Each reported
fact has an assigned severity, one of:

error  : Items marked as errors are considered severe problems requiring
         immediate attention.
warning: Either less severe problems or uncommon structural features. These
         still need special attention.
note   : Statistical values, plots, or other verbose results of tests and
         analyses that have been performed.

If alternate conformations are present, only the first is evaluated. Hydrogen
atoms are only included if explicitly requested, and even then they are not
used in all checks. The software functions less well for non-canonical amino
acids and exotic ligands than for the 20 canonical residues and canonical
nucleic acids.

Some remarks regarding the output:

Residues/atoms in tables are normally given in a few parts:

A number. This is the internal sequence number of the residue used by WHAT IF.
    The first residues in the file get number 1, 2, etc.
The residue type. Normally this is a three letter amino acid type.
The sequence number, between brackets. This is the residue number as it was
    given in the input file. It can be followed by the insertion code.
The chain identifier. A single character. If no chain identifier was given in
    the input file, this will be a minus sign or a blank.
A model number. If no model number exists, like in most X-ray files, this will
    be a blank or occasionally a minus sign.
In case an atom is part of the output, the atom will be listed using the PDB
    nomenclature for type and identifier.

To indicate the normality of a score, the score may be expressed as a Z-value
   or Z-score. This is just the number of standard deviations that the score
   deviates from the expected value. A property of Z-values is that the
   root-mean-square of a group of Z-values (the RMS Z-value) is expected to be
   1.0. Z-values above 4.0 and below -4.0 are very uncommon. If a Z-score is
   used in WHAT IF, the accompanying text will explain how the expected value
   and standard deviation were obtained.
The names of nucleic acids are DGUA, DTHY, OCYT, OADE, etc. The first character
   is a D or O for DNA or RNA respectively. This circumvents ambiguities in the
   many old PDB files in which DNA and RNA were both called A, C, G, and T.



=========================================
==== Compound code /zata/tempdir/6q45/wctemf/6q45_final.pdb         ====
=========================================
 
# 1 # Note: Introduction
WHAT CHECK needs to read a PDB file before it can check it. It does a
series of checks upon reading the file. The results of these checks are
reported in this section (section 2.1). The rest of the report will be more
systematic in that section 2.2 reports on administrative problems. Section
2.3 gives descriptive output that is not directly validating things but
more telling you how WHAT CHECK interpreted the input file. Section 2.4
looks at B-factors, occupancies, and the presence/absence of (spurious)
atoms. Section 2.5 deals with nomenclature problems. Section 2.6 deals with
geometric problems like bond lengths and bond angles. Section 2.7 deals with
torsion angle issues. Section 2.8 looks at atomic clashes. Section 2.9 deals
with packing, accessibility, etc, issues. Section 2.10 deals with hydrogen
bonds, ion packing, and other things that can be summarized under the common
name charge-charge interactions. Section 2.11 gives a summary of whole report
and tells you (if applicable) which symmetry matrices were used. Section 2.12
tells the crystallographer which are the things most in need of manual
correction. And the last section, section 2.13, lists all residues sorted
by their need for visual inspection in light of the electron density.
WARNING. Date error on HEADER card:
HEADER                                                        6Q45
 
# 2 # Note: Header records from PDB file
Header records from PDB file.
 
HEADER                                                        6Q45
 
# 3 # Warning: Low resolution causes poor validation
The resolution at which this PDB file has been solved is rather poor.
This means that many of the checks in this validation report can be
meaningless.
 
# 4 # Error: Missing unit cell information
No SCALE matrix is given in the PDB file.
 
# 5 # Note: Proposal for corrected SCALE matrix
A corrected SCALE matrix has been derived.
 
Proposed scale matrix
  0.008933  0.000000  0.001931
  0.000000  0.004995  0.000000
  0.000000  0.000000  0.005072
 
# 6 # Note: Non crystallographic symmetry RMS plot
The plot shows the RMS differences between two similar chains on a residue-
by-residue basis. Individual "spikes" can be indicative of interesting or
wrong residues. If all residues show a high RMS value, the structure could
be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: A and B
 
 All-atom RMS fit for the two chains : 1.495
 CA-only RMS fit for the two chains : 1.304
 
# 7 # Note: Non crystallographic symmetry backbone difference plot
The plot shows the differences in backbone torsion angles between two
similar chains on a residue-by-residue basis. Individual "spikes" can be
indicative of interesting or wrong residues. If all residues show high
differences, the structure could be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: A and B
 
# 8 # Note: Non crystallographic symmetry RMS plot
The plot shows the RMS differences between two similar chains on a residue-
by-residue basis. Individual "spikes" can be indicative of interesting or
wrong residues. If all residues show a high RMS value, the structure could
be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: A and C
 
 All-atom RMS fit for the two chains : 10.234
 CA-only RMS fit for the two chains : 9.827
 
# 9 # Note: Non crystallographic symmetry backbone difference plot
The plot shows the differences in backbone torsion angles between two
similar chains on a residue-by-residue basis. Individual "spikes" can be
indicative of interesting or wrong residues. If all residues show high
differences, the structure could be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: A and C
 
# 10 # Note: Non crystallographic symmetry RMS plot
The plot shows the RMS differences between two similar chains on a residue-
by-residue basis. Individual "spikes" can be indicative of interesting or
wrong residues. If all residues show a high RMS value, the structure could
be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: A and I
 
 All-atom RMS fit for the two chains : 0.284
 CA-only RMS fit for the two chains : 0.205
 
# 11 # Note: Low non-crystallographic symmetry phi and psi differences
All comparable residues in the two chains mentioned below have comparable
backbone torsion angles
 
Chain identifiers of the two chains: A and I
 
# 12 # Note: Non crystallographic symmetry RMS plot
The plot shows the RMS differences between two similar chains on a residue-
by-residue basis. Individual "spikes" can be indicative of interesting or
wrong residues. If all residues show a high RMS value, the structure could
be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: A and K
 
 All-atom RMS fit for the two chains : 7.504
 CA-only RMS fit for the two chains : 7.350
 
# 13 # Note: Non crystallographic symmetry backbone difference plot
The plot shows the differences in backbone torsion angles between two
similar chains on a residue-by-residue basis. Individual "spikes" can be
indicative of interesting or wrong residues. If all residues show high
differences, the structure could be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: A and K
 
# 14 # Note: Non crystallographic symmetry RMS plot
The plot shows the RMS differences between two similar chains on a residue-
by-residue basis. Individual "spikes" can be indicative of interesting or
wrong residues. If all residues show a high RMS value, the structure could
be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: B and I
 
 All-atom RMS fit for the two chains : 1.436
 CA-only RMS fit for the two chains : 1.244
 
# 15 # Note: Non crystallographic symmetry backbone difference plot
The plot shows the differences in backbone torsion angles between two
similar chains on a residue-by-residue basis. Individual "spikes" can be
indicative of interesting or wrong residues. If all residues show high
differences, the structure could be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: B and I
 
# 16 # Note: NCS statistics suppressed
There are more pairs of NCS equivalent molecules, but the statistics
will not be shown.
 
# 17 # Warning: Problem detected upon counting molecules and matrices
The parameter Z as given on the CRYST card represents the molecular
multiplicity in the crystallographic cell. Normally, Z equals the number of
matrices of the space group multiplied by the number of NCS relations. The
value of Z is multiplied by the integrated molecular weight of the molecules
in the file to determine the Matthews coefficient. This relation is being
validated in this option. Be aware that the validation can get confused if
both multiple copies of the molecule are present in the ATOM records and
MTRIX records are present in the header of the PDB file.
 
 Space group as read from CRYST card: P 1 21 1
 Number of matrices in space group: 2
 Highest polymer chain multiplicity in structure: 6
 Highest polymer chain multiplicity according to SEQRES: 3
 There is also strong SEQRES evidence for a multiplicity of: 6
 No explicit MTRIX NCS matrices found in the input file
 Value of Z as found on the CRYST1 card: 0
 Polymer chain multiplicity and SEQRES multiplicity disagree 6 3
 Z agrees neither with the 3D multiplicity, nor with the SEQRES multiplicity
 It could be that Z must be one of: 6 12
 
# 18 # Error: Matthews Coefficient (Vm) very high
 
The Matthews coefficient [REF] is defined as the density of the protein
structure in cubic Angstroms per Dalton. Normal values are between 1.5
(tightly packed, little room for solvent) and 4.0 (loosely packed, much
space for solvent). Some very loosely packed structures can get values a bit
higher than that.
 
Numbers this high are almost always caused by giving the wrong value for Z
on the CRYST1 card (or not giving this number at all).
 
 Molecular weight of all polymer chains: 703043.375
 Volume of the Unit Cell V= 4418838.0
 Space group multiplicity: 2
 No NCS symmetry matrices (MTRIX records) found in PDB file
 Matthews coefficient for observed atoms and Z is high: Vm= 18.856
 No Matthews coefficient given in REMARK 280
 SEQRES and ATOM multiplicities disagree. Error-reasoning thus is difficult.
 (and the absence of MTRIX records doesn't help)
 And remember, a matrix counting problem has been reported earlier already
 
# 19 # Note: All atoms are sufficiently far away from symmetry axes
None of the atoms in the structure is closer than 0.77 Angstrom to a proper
symmetry axis.
 
# 20 # Note: Chain identifiers OK
WHAT CHECK has not detected any serious chain identifier problems. But be
aware that WHAT CHECK doesn't care about the chain identifiers of waters.
 
# 21 # Warning: Ligands for which a topology was generated automatically
The topology for the ligands in the table below were determined
automatically. WHAT CHECK uses a local copy of the CCP4 monomer library to
generate topology information for ligands. Be aware that automatic topology
generation is a complicated task. So, if you get messages that you fail to
understand or that you believe are wrong, and one of these ligands is
involved, then check the ligand topology entry first. This topology is either
present in the monomer library, or as a libcheck-generated file in the local
directory.
 
 6431 ATP  ( 600-) A  -
 6433 ATP  ( 600-) B  -
 6435 ATP  ( 600-) C  -
 6437 ADP  ( 600-) D  -
 6439 ADP  ( 600-) F  -
 6441 ATP  ( 600-) I  -
 6443 ATP  ( 600-) J  -
 6445 ATP  ( 600-) K  -
 6447 ADP  ( 600-) L  -
 6449 ADP  ( 600-) N  -
 
# 22 # Note: Covalently bound ligands
No problems were detected that seem related to covalently bound ligands.
 
# 23 # Note: No strange inter-chain connections detected
No covalent bonds have been detected between molecules with non-identical
chain identifiers.
 
# 24 # Note: No duplicate atom names in ligands
All atom names in ligands (if any) seem adequately unique.
 
# 25 # Note: In all cases the primary alternate atom was used
WHAT CHECK saw no need to make any alternate atom corrections (which means
they either are all correct, or there are none).
 
# 26 # Note: No residues detected inside ligands
Either this structure does not contain ligands with amino acid groups inside
it, or their naming is proper (enough).
 
# 27 # Note: No attached groups interfere with hydrogen bond calculations
It seems there are no sugars, lipids, etc., bound (or very close) to atoms
that otherwise could form hydrogen bonds.
 
# 28 # Note: No probable side chain atoms with zero occupancy detected.
Either there are no side chain atoms with zero occupancy, or the side chain
atoms with zero occupancy were not present in the input PDB file (in which
case they are listed as missing atoms), or their positions are sufficiently
improbable to warrant a zero occupancy.
 
# 29 # Note: No probable backbone atoms with zero occupancy detected.
Either there are no backbone atoms with zero occupancy, or the backbone
atoms with zero occupancy were left out of the input PDB file (in
which case they are listed as missing atoms), or their positions are
sufficiently improbable to warrant a zero occupancy.
 
# 30 # Note: All residues have a complete backbone.
No residues have missing backbone atoms.
 
# 31 # Note: No C-alpha only residues
There are no residues that consist of only an alpha carbon atom.
 
# 32 # Note: Content of the PDB file as interpreted by WHAT CHECK
Content of the PDB file as interpreted by WHAT CHECK.
WHAT CHECK has read your PDB file, and stored it internally in what is called
'the soup'. The content of this soup is listed here. An extensive explanation
of all frequently used WHAT CHECK output formats can be found at
swift.cmbi.ru.nl. Look under output formats. A course on reading this
'Molecules' table is part of the WHAT CHECK website.
 
     1     1 (   25)   476 (  500) A Protein             /zata/tempdir/6q4...
     2   477 (   27)   950 (  500) B Protein             /zata/tempdir/6q4...
     3   951 (   25)  1421 (  500) C Protein             /zata/tempdir/6q4...
     4  1422 (    1)  1881 (  460) D Protein             /zata/tempdir/6q4...
     5  1882 (    1)  2341 (  460) E Protein             /zata/tempdir/6q4...
     6  2342 (    1)  2803 (  462) F Protein             /zata/tempdir/6q4...
     7  2804 (    2)  3084 (  282) G Protein             /zata/tempdir/6q4...
     8  3085 (    1)  3218 (  134) H Protein             /zata/tempdir/6q4...
     9  3219 (   27)  3692 (  500) I Protein             /zata/tempdir/6q4...
    10  3693 (   26)  4161 (  500) J Protein             /zata/tempdir/6q4...
    11  4162 (   27)  4627 (  495) K Protein             /zata/tempdir/6q4...
    12  4628 (    2)  5086 (  460) L Protein             /zata/tempdir/6q4...
    13  5087 (    2)  5545 (  460) M Protein             /zata/tempdir/6q4...
    14  5546 (    1)  6005 (  460) N Protein             /zata/tempdir/6q4...
    15  6006 (    2)  6286 (  282) O Protein             /zata/tempdir/6q4...
And so on for a total of    56 lines.
MODELs skipped upon reading PDB file: 0
X-ray structure. No MODELs found
The total number of amino acids found is 6420
of which 222 have poor or (essentially) missing atoms
No nucleic acids observed in input file
No sugars recognized in input file
Number of water molecules: 34
Residue numbers increase monotonously OK
 
# 33 # Note: Chain identifiers seem OK
All ions seem to have a logical chain identifier, or there are no ions
present in the input file.
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
 
# 34 # Note: Ramachandran plot
In this Ramachandran plot x-signs represent glycines, squares represent
prolines, and plus-signs represent the other residues. If too many
plus-signs fall outside the contoured areas then the molecule is poorly
refined (or worse). Proline can only occur in the narrow region around
phi=-60 that also falls within the other contour islands.
 
In a colour picture, the residues that are part of a helix are shown in blue,
strand residues in red. Preferred regions for helical residues are drawn in
blue, for strand residues in red, and for all other residues in green. A full
explanation of the Ramachandran plot together with a series of examples can
be found at the WHAT CHECK website [REF].
 
In the TeX file, a plot has been inserted here
 
Chain identifier: A
 
# 35 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: B
 
# 36 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: C
 
# 37 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: D
 
# 38 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: E
 
# 39 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: F
 
# 40 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: G
 
# 41 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: H
 
# 42 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: I
 
# 43 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: J
 
# 44 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: K
 
# 45 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: L
 
# 46 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: M
 
# 47 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: N
 
# 48 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: O
 
# 49 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: P
 
# 50 # Note: Secondary structure
This is the secondary structure according to DSSP. Only helix (H), overwound
or 3/10-helix (3), strand (S), turn (T) and coil (blank) are shown [REF].
All DSSP related information can be found at swift.cmbi.ru.nl/gv/dssp/
This is not really a structure validation option, but a very scattered
secondary structure (i.e. many strands of only a few residues length, many
Ts inside helices, etc) tends to indicate a poor structure. A full
explanation of the DSSP secondary structure determination program together
with a series of examples can be found at the WHAT CHECK website [REF].
 
Secondary structure assignment
                     10        20        30        40        50        60
                      |         |         |         |         |         |
    1 -   60 IKTSGTVLEVGDGIARIFGLSNVMSGELLEFPHGVMGMALNLEEDNVGAVILGNASLIKE
(  25)-(  84)
                     70        80        90       100       110       120
                      |         |         |         |         |         |
   61 -  120 GDEVRATGKVVSVPAGEDLLGRVINALGDPIDGKGEIHVDKYMPIERKASGIIARQPVSE
(  85)-( 144)
                    130       140       150       160       170       180
                      |         |         |         |         |         |
  121 -  180 PLQTGIKSIDGMVPIGRGQRELIIGDRQTGKTAIAIDTIINQKGQDVKCIYVAIGQKRST
( 145)-( 204)
                    190       200       210       220       230       240
                      |         |         |         |         |         |
  181 -  240 VAQIYKKLSDLGCMDYTIIVAATASEAAPLQYMAPYSGVAIGEYFMEKGEHVLIIYDDLS
( 205)-( 264)
                    250       260       270       280       290       300
                      |         |         |         |         |         |
  241 -  300 KHAVAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSITALPIIETQAG
( 265)-( 324)
                    310       320       330       340       350       360
                      |         |         |         |         |         |
  301 -  360 DVSAYIPTNVISITDGQIFLESQLFNSGFRPAINAGISVSRVGGAAQIKAMKQVASKVKL
( 325)-( 384)
                    370       380       390       400       410       420
                      |         |         |         |         |         |
  361 -  420 ELAQYTELLTFAQFGSDLDKATKAQLERGHRIMEILKQPQYHPFAVERQVVSFYIVINGH
( 385)-( 444)
                    430       440       450       460       470
                      |         |         |         |         |
  421 -  476 LDDIEVSKVRRFEKELLDYLKANTNILTEIADKKALDKDLEEKLKESIANFKKSFN
( 445)-( 500)
              480       490       500       510       520       530
                |         |         |         |         |         |
  477 -  536 TSGTVLEVGDGIARIFGLSNVMSGELLEFPHGVMGMALNLEEDNVGAVILGNASLIKEGD
(  27)-(  86)
              540       550       560       570       580       590
                |         |         |         |         |         |
  537 -  596 EVRATGKVVSVPAGEDLLGRVINALGDPIDGKGEIHVDKYMPIERKASGIIARQPVSEPL
(  87)-( 146)
              600       610       620       630       640       650
                |         |         |         |         |         |
  597 -  656 QTGIKSIDGMVPIGRGQRELIIGDRQTGKTAIAIDTIINQKGQDVKCIYVAIGQKRSTVA
( 147)-( 206)
              660       670       680       690       700       710
                |         |         |         |         |         |
  657 -  716 QIYKKLSDLGCMDYTIIVAATASEAAPLQYMAPYSGVAIGEYFMEKGEHVLIIYDDLSKH
( 207)-( 266)
              720       730       740       750       760       770
                |         |         |         |         |         |
  717 -  776 AVAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSITALPIIETQAGDV
( 267)-( 326)
              780       790       800       810       820       830
                |         |         |         |         |         |
  777 -  836 SAYIPTNVISITDGQIFLESQLFNSGFRPAINAGISVSRVGGAAQIKAMKQVASKVKLEL
( 327)-( 386)
              840       850       860       870       880       890
                |         |         |         |         |         |
  837 -  896 AQYTELLTFAQFGSDLDKATKAQLERGHRIMEILKQPQYHPFAVERQVVSFYIVINGHLD
( 387)-( 446)
              900       910       920       930       940       950
                |         |         |         |         |         |
  897 -  950 DIEVSKVRRFEKELLDYLKANTNILTEIADKKALDKDLEEKLKESIANFKKSFN
( 447)-( 500)
                    960       970       980       990      1000      1010
                      |         |         |         |         |         |
  951 - 1010 IKTSGTVLEVGDGIARIFGLSNVMSGELLEFPHGVMGMALNLEEDNVGAVILGNASLIKE
(  25)-(  84)
                   1020      1030      1040      1050      1060      1070
                      |         |         |         |         |         |
 1011 - 1070 GDEVRATGKVVSVPAGEDLLGRVINALGDPIDGKGEIHVDKYMPIERKASGIIARQPVSE
(  85)-( 144)
                   1080      1090      1100      1110      1120      1130
                      |         |         |         |         |         |
 1071 - 1130 PLQTGIKSIDGMVPIGRGQRELIIGDRQTGKTAIAIDTIINQKGQDVKCIYVAIGQKRST
( 145)-( 204)
                   1140      1150      1160      1170      1180      1190
                      |         |         |         |         |         |
 1131 - 1190 VAQIYKKLSDLGCMDYTIIVAATASEAAPLQYMAPYSGVAIGEYFMEKGEHVLIIYDDLS
( 205)-( 264)
                   1200      1210      1220      1230      1240      1250
                      |         |         |         |         |         |
 1191 - 1250 KHAVAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSITALPIIETQAG
( 265)-( 324)
                   1260      1270      1280      1290      1300      1310
                      |         |         |         |         |         |
 1251 - 1310 DVSAYIPTNVISITDGQIFLESQLFNSGFRPAINAGISVSRVGGAAQIKAMKQVASKVKL
( 325)-( 384)
                   1320      1330      1340      1350      1360      1370
                      |         |         |         |         |         |
 1311 - 1370 ELAQYTELLTFAQDKATKAQLERGHRIMEILKQPQYHPFAVERQVVSFYIVINGHLDDIE
( 385)-( 449)
                   1380      1390      1400      1410      1420
                      |         |         |         |         |
 1371 - 1421 VSKVRRFEKELLDYLKANTNILTEIADKKALDKDLEEKLKESIANFKKSFN
( 450)-( 500)
                  1430      1440      1450      1460      1470      1480
                     |         |         |         |         |         |
 1422 - 1481 MNKGTITQIISAVVDIAFKDELPAIYNALKVKLEDKELVLEVEQHLGNNVVRTVAMDSTD
(   1)-(  60)
                  1490      1500      1510      1520      1530      1540
                     |         |         |         |         |         |
 1482 - 1541 GLKRGMEVIDTGKPITIPVGKAVLGRILNVLGEPVDNQGPLNAETFLPIHREAPEFDDLE
(  61)-( 120)
                  1550      1560      1570      1580      1590      1600
                     |         |         |         |         |         |
 1542 - 1601 TETEIFETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIMELINNIAKGHGGISVFAGVG
( 121)-( 180)
                  1610      1620      1630      1640      1650      1660
                     |         |         |         |         |         |
 1602 - 1661 ERTREGRDLYGEMTESGVITKTALVYGQMNEPPGARLRVALTGLTVAENFRDKDGQDVLL
( 181)-( 240)
                  1670      1680      1690      1700      1710      1720
                     |         |         |         |         |         |
 1662 - 1721 FIDNIFRFTQAGSEVSALLGRIPSAVGYQPNLATEMGALQERITSTKSGSITSVQAVYVP
( 241)-( 300)
                  1730      1740      1750      1760      1770      1780
                     |         |         |         |         |         |
 1722 - 1781 ADDLTDPAPATTFSHLDATTVLSRNIASLGIYPAVDPLDSTSKALSEDVVGKEHYEVARK
( 301)-( 360)
                  1790      1800      1810      1820      1830      1840
                     |         |         |         |         |         |
 1782 - 1841 VQEVLQRYKELQDIIAILGMDELSDEDKLTVSRARKIERFFSQPFSVAEQFTGMEGKYVP
( 361)-( 420)
                  1850      1860      1870      1880
                     |         |         |         |
 1842 - 1881 VKETIRGFREILEGKHDDIPEQAFLYVGTIEEAVAKSKDL
( 421)-( 460)
                  1890      1900      1910      1920      1930      1940
                     |         |         |         |         |         |
 1882 - 1941 MNKGTITQIISAVVDIAFKDELPAIYNALKVKLEDKELVLEVEQHLGNNVVRTVAMDSTD
(   1)-(  60)
                  1950      1960      1970      1980      1990      2000
                     |         |         |         |         |         |
 1942 - 2001 GLKRGMEVIDTGKPITIPVGKAVLGRILNVLGEPVDNQGPLNAETFLPIHREAPEFDDLE
(  61)-( 120)
                  2010      2020      2030      2040      2050      2060
                     |         |         |         |         |         |
 2002 - 2061 TETEIFETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIMELINNIAKGHGGISVFAGVG
( 121)-( 180)
                  2070      2080      2090      2100      2110      2120
                     |         |         |         |         |         |
 2062 - 2121 ERTREGRDLYGEMTESGVITKTALVYGQMNEPPGARLRVALTGLTVAENFRDKDGQDVLL
( 181)-( 240)
                  2130      2140      2150      2160      2170      2180
                     |         |         |         |         |         |
 2122 - 2181 FIDNIFRFTQAGSEVSALLGRIPSAVGYQPNLATEMGALQERITSTKSGSITSVQAVYVP
( 241)-( 300)
                  2190      2200      2210      2220      2230      2240
                     |         |         |         |         |         |
 2182 - 2241 ADDLTDPAPATTFSHLDATTVLSRNIASLGIYPAVDPLDSTSKALSEDVVGKEHYEVARK
( 301)-( 360)
                  2250      2260      2270      2280      2290      2300
                     |         |         |         |         |         |
 2242 - 2301 VQEVLQRYKELQDIIAILGMDELSDEDKLTVSRARKIERFFSQPFSVAEQFTGMEGKYVP
( 361)-( 420)
                  2310      2320      2330      2340
                     |         |         |         |
 2302 - 2341 VKETIRGFREILEGKHDDIPEQAFLYVGTIEEAVAKSKDL
( 421)-( 460)
                  2350      2360      2370      2380      2390      2400
                     |         |         |         |         |         |
 2342 - 2401 MNKGTITQIISAVVDIAFKDELPAIYNALKVKLEDKELVLEVEQHLGNNVVRTVAMDSTD
(   1)-(  60)
                  2410      2420      2430      2440      2450      2460
                     |         |         |         |         |         |
 2402 - 2461 GLKRGMEVIDTGKPITIPVGKAVLGRILNVLGEPVDNQGPLNAETFLPIHREAPEFDDLE
(  61)-( 120)
                  2470      2480      2490      2500      2510      2520
                     |         |         |         |         |         |
 2462 - 2521 TETEIFETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIMELINNIAKGHGGISVFAGVG
( 121)-( 180)
                  2530      2540      2550      2560      2570      2580
                     |         |         |         |         |         |
 2522 - 2581 ERTREGRDLYGEMTESGVITKTALVYGQMNEPPGARLRVALTGLTVAENFRDKDGQDVLL
( 181)-( 240)
                  2590      2600      2610      2620      2630      2640
                     |         |         |         |         |         |
 2582 - 2641 FIDNIFRFTQAGSEVSALLGRIPSAVGYQPNLATEMGALQERITSTKSGSITSVQAVYVP
( 241)-( 300)
                  2650      2660      2670      2680      2690      2700
                     |         |         |         |         |         |
 2642 - 2701 ADDLTDPAPATTFSHLDATTVLSRNIASLGIYPAVDPLDSTSKALSEDVVGKEHYEVARK
( 301)-( 360)
                  2710      2720      2730      2740      2750      2760
                     |         |         |         |         |         |
 2702 - 2761 VQEVLQRYKELQDIIAILGMDELSDEDKLTVSRARKIERFFSQPFSVAEQFTGMEGKYVP
( 361)-( 420)
                  2770      2780      2790      2800
                     |         |         |         |
 2762 - 2803 VKETIRGFREILEGKHDDIPEQAFLYVGTIEEAVAKSKDLAK
( 421)-( 462)
                2810      2820      2830      2840      2850      2860
                   |         |         |         |         |         |
 2804 - 2863 PGMKEIKSRIKSVQSTRQITNAMEIVSTTKFKRYSKLVTESRPYEESMRKILGNIASGVK
(   2)-(  61)
                2870      2880      2890      2900      2910      2920
                   |         |         |         |         |         |
 2864 - 2923 NEGHPLFDGRKEVKSIAIIVITSDRGLCGSFNSSTLKELEKLVEKNKNKNITIIPFGRKA
(  62)-( 121)
                2930      2940      2950      2960      2970      2980
                   |         |         |         |         |         |
 2924 - 2983 IDFITKRNYEFSESFSKISPDEMNKIAGEISEEVVEKYNNHIYDEVYVIYNKFISALRYD
( 122)-( 181)
                2990      3000      3010      3020      3030      3040
                   |         |         |         |         |         |
 2984 - 3043 LTCERIIPITRPEVELNSEYIFEPSTEYILSALLPRFINLQIYQAILNNTASEHSARKNS
( 182)-( 241)
                3050      3060      3070      3080
                   |         |         |         |
 3044 - 3084 MSSATDNADEMIKTLNIKYNRNRQSAITQEITEIVGGASAL
( 242)-( 282)
               3090      3100      3110      3120      3130      3140
                  |         |         |         |         |         |
 3085 - 3144 MPSFDVSVVTQVKKILEQEAGYLRLRTSEGDIGILPNHAPFVAELSMGKMEIESPNKDRR
(   1)-(  60)
               3150      3160      3170      3180      3190      3200
                  |         |         |         |         |         |
 3145 - 3204 DIYFLSGGFLEISDNQATVIADEVFPIEKIDVESEQALVENLKKELEKVSTEEEKRKLQK
(  61)-( 120)
               3210
                  |
 3205 - 3218 KIKISLAKIDAKNN
( 121)-( 134)
           3220      3230      3240      3250      3260      3270
              |         |         |         |         |         |
 3219 - 3278 TSGTVLEVGDGIARIFGLSNVMSGELLEFPHGVMGMALNLEEDNVGAVILGNASLIKEGD
(  27)-(  86)
           3280      3290      3300      3310      3320      3330
              |         |         |         |         |         |
 3279 - 3338 EVRATGKVVSVPAGEDLLGRVINALGDPIDGKGEIHVDKYMPIERKASGIIARQPVSEPL
(  87)-( 146)
           3340      3350      3360      3370      3380      3390
              |         |         |         |         |         |
 3339 - 3398 QTGIKSIDGMVPIGRGQRELIIGDRQTGKTAIAIDTIINQKGQDVKCIYVAIGQKRSTVA
( 147)-( 206)
           3400      3410      3420      3430      3440      3450
              |         |         |         |         |         |
 3399 - 3458 QIYKKLSDLGCMDYTIIVAATASEAAPLQYMAPYSGVAIGEYFMEKGEHVLIIYDDLSKH
( 207)-( 266)
           3460      3470      3480      3490      3500      3510
              |         |         |         |         |         |
 3459 - 3518 AVAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSITALPIIETQAGDV
( 267)-( 326)
           3520      3530      3540      3550      3560      3570
              |         |         |         |         |         |
 3519 - 3578 SAYIPTNVISITDGQIFLESQLFNSGFRPAINAGISVSRVGGAAQIKAMKQVASKVKLEL
( 327)-( 386)
           3580      3590      3600      3610      3620      3630
              |         |         |         |         |         |
 3579 - 3638 AQYTELLTFAQFGSDLDKATKAQLERGHRIMEILKQPQYHPFAVERQVVSFYIVINGHLD
( 387)-( 446)
           3640      3650      3660      3670      3680      3690
              |         |         |         |         |         |
 3639 - 3692 DIEVSKVRRFEKELLDYLKANTNILTEIADKKALDKDLEEKLKESIANFKKSFN
( 447)-( 500)
                 3700      3710      3720      3730      3740      3750
                    |         |         |         |         |         |
 3693 - 3752 KTSGTVLEVGDGIARIFGLSNVMSGELLEFPHGVMGMALNLEEDNVGAVILGNASLIKEG
(  26)-(  85)
                 3760      3770      3780      3790      3800      3810
                    |         |         |         |         |         |
 3753 - 3812 DEVRATGKVVSVPAGEDLLGRVINALGDPIDGKGEIHVDKYMPIERKASGIIARQPVSEP
(  86)-( 145)
                 3820      3830      3840      3850      3860      3870
                    |         |         |         |         |         |
 3813 - 3872 LQTGIKSIDGMVPIGRGQRELIIGDRQTGKTAIAIDTIINQKGQDVKCIYVAIGQKRSTV
( 146)-( 205)
                 3880      3890      3900      3910      3920      3930
                    |         |         |         |         |         |
 3873 - 3932 AQIYKKLSDLGCMDYTIIVAATASEAAPLQYMAPYSGVAIGEYFMEKGEHVLIIYDDLSK
( 206)-( 265)
                 3940      3950      3960      3970      3980      3990
                    |         |         |         |         |         |
 3933 - 3992 HAVAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSITALPIIETQAGD
( 266)-( 325)
                 4000      4010      4020      4030      4040      4050
                    |         |         |         |         |         |
 3993 - 4052 VSAYIPTNVISITDGQIFLESQLFNSGFRPAINAGISVSRVGGAAQIKAMKQVASKVKLE
( 326)-( 385)
                 4060      4070      4080      4090      4100      4110
                    |         |         |         |         |         |
 4053 - 4112 LAQYTELLTFAQKATKAQLERGHRIMEILKQPQYHPFAVERQVVSFYIVINGHLDDIEVS
( 386)-( 451)
                 4120      4130      4140      4150      4160
                    |         |         |         |         |
 4113 - 4161 KVRRFEKELLDYLKANTNILTEIADKKALDKDLEEKLKESIANFKKSFN
( 452)-( 500)
                  4170      4180      4190      4200      4210      4220
                     |         |         |         |         |         |
 4162 - 4221 TSGTVLEVGDGIARIFGLSNVMSGELLEFPHGVMGMALNLEEDNVGAVILGNASLIKEGD
(  27)-(  86)
                  4230      4240      4250      4260      4270      4280
                     |         |         |         |         |         |
 4222 - 4281 EVRATGKVVSVPAGEDLLGRVINALGDPIDGKGEIHVDKYMPIERKASGIIARQPVSEPL
(  87)-( 146)
                  4290      4300      4310      4320      4330      4340
                     |         |         |         |         |         |
 4282 - 4341 QTGIKSIDGMVPIGRGQRELIIGDRQTGKTAIAIDTIINQKGQDVKCIYVAIGQKRSTVA
( 147)-( 206)
                  4350      4360      4370      4380      4390      4400
                     |         |         |         |         |         |
 4342 - 4401 QIYKKLSDLGCMDYTIIVAATASEAAPLQYMAPYSGVAIGEYFMEKGEHVLIIYDDLSKH
( 207)-( 266)
                  4410      4420      4430      4440      4450      4460
                     |         |         |         |         |         |
 4402 - 4461 AVAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSITALPIIETQAGDV
( 267)-( 326)
                  4470      4480      4490      4500      4510      4520
                     |         |         |         |         |         |
 4462 - 4521 SAYIPTNVISITDGQIFLESQLFNSGFRPAINAGISVSRVGGAAQIKAMKQVASKVKLEL
( 327)-( 386)
                  4530      4540      4550      4560      4570      4580
                     |         |         |         |         |         |
 4522 - 4581 AQYTELLTFAQFGSKATKAQLERGHRIMEILKQPQYHPFAVERQVVSFYIVINGHLDDIE
( 387)-( 449)
                  4590      4600      4610      4620
                     |         |         |         |
 4582 - 4627 VSKVRRFEKELLDYLKANTNILTEIADKKALDKDLEEKLKESIANF
( 450)-( 495)
            4630      4640      4650      4660      4670      4680
               |         |         |         |         |         |
 4628 - 4687 NKGTITQIISAVVDIAFKDELPAIYNALKVKLEDKELVLEVEQHLGNNVVRTVAMDSTDG
(   2)-(  61)
            4690      4700      4710      4720      4730      4740
               |         |         |         |         |         |
 4688 - 4747 LKRGMEVIDTGKPITIPVGKAVLGRILNVLGEPVDNQGPLNAETFLPIHREAPEFDDLET
(  62)-( 121)
            4750      4760      4770      4780      4790      4800
               |         |         |         |         |         |
 4748 - 4807 ETEIFETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIMELINNIAKGHGGISVFAGVGE
( 122)-( 181)
            4810      4820      4830      4840      4850      4860
               |         |         |         |         |         |
 4808 - 4867 RTREGRDLYGEMTESGVITKTALVYGQMNEPPGARLRVALTGLTVAENFRDKDGQDVLLF
( 182)-( 241)
            4870      4880      4890      4900      4910      4920
               |         |         |         |         |         |
 4868 - 4927 IDNIFRFTQAGSEVSALLGRIPSAVGYQPNLATEMGALQERITSTKSGSITSVQAVYVPA
( 242)-( 301)
            4930      4940      4950      4960      4970      4980
               |         |         |         |         |         |
 4928 - 4987 DDLTDPAPATTFSHLDATTVLSRNIASLGIYPAVDPLDSTSKALSEDVVGKEHYEVARKV
( 302)-( 361)
            4990      5000      5010      5020      5030      5040
               |         |         |         |         |         |
 4988 - 5047 QEVLQRYKELQDIIAILGMDELSDEDKLTVSRARKIERFFSQPFSVAEQFTGMEGKYVPV
( 362)-( 421)
            5050      5060      5070      5080
               |         |         |         |
 5048 - 5086 KETIRGFREILEGKHDDIPEQAFLYVGTIEEAVAKSKDL
( 422)-( 460)
             5090      5100      5110      5120      5130      5140
                |         |         |         |         |         |
 5087 - 5146 NKGTITQIISAVVDIAFKDELPAIYNALKVKLEDKELVLEVEQHLGNNVVRTVAMDSTDG
(   2)-(  61)
             5150      5160      5170      5180      5190      5200
                |         |         |         |         |         |
 5147 - 5206 LKRGMEVIDTGKPITIPVGKAVLGRILNVLGEPVDNQGPLNAETFLPIHREAPEFDDLET
(  62)-( 121)
             5210      5220      5230      5240      5250      5260
                |         |         |         |         |         |
 5207 - 5266 ETEIFETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIMELINNIAKGHGGISVFAGVGE
( 122)-( 181)
             5270      5280      5290      5300      5310      5320
                |         |         |         |         |         |
 5267 - 5326 RTREGRDLYGEMTESGVITKTALVYGQMNEPPGARLRVALTGLTVAENFRDKDGQDVLLF
( 182)-( 241)
             5330      5340      5350      5360      5370      5380
                |         |         |         |         |         |
 5327 - 5386 IDNIFRFTQAGSEVSALLGRIPSAVGYQPNLATEMGALQERITSTKSGSITSVQAVYVPA
( 242)-( 301)
             5390      5400      5410      5420      5430      5440
                |         |         |         |         |         |
 5387 - 5446 DDLTDPAPATTFSHLDATTVLSRNIASLGIYPAVDPLDSTSKALSEDVVGKEHYEVARKV
( 302)-( 361)
             5450      5460      5470      5480      5490      5500
                |         |         |         |         |         |
 5447 - 5506 QEVLQRYKELQDIIAILGMDELSDEDKLTVSRARKIERFFSQPFSVAEQFTGMEGKYVPV
( 362)-( 421)
             5510      5520      5530      5540
                |         |         |         |
 5507 - 5545 KETIRGFREILEGKHDDIPEQAFLYVGTIEEAVAKSKDL
( 422)-( 460)
              5550      5560      5570      5580      5590      5600
                 |         |         |         |         |         |
 5546 - 5605 MNKGTITQIISAVVDIAFKDELPAIYNALKVKLEDKELVLEVEQHLGNNVVRTVAMDSTD
(   1)-(  60)
              5610      5620      5630      5640      5650      5660
                 |         |         |         |         |         |
 5606 - 5665 GLKRGMEVIDTGKPITIPVGKAVLGRILNVLGEPVDNQGPLNAETFLPIHREAPEFDDLE
(  61)-( 120)
              5670      5680      5690      5700      5710      5720
                 |         |         |         |         |         |
 5666 - 5725 TETEIFETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIMELINNIAKGHGGISVFAGVG
( 121)-( 180)
              5730      5740      5750      5760      5770      5780
                 |         |         |         |         |         |
 5726 - 5785 ERTREGRDLYGEMTESGVITKTALVYGQMNEPPGARLRVALTGLTVAENFRDKDGQDVLL
( 181)-( 240)
              5790      5800      5810      5820      5830      5840
                 |         |         |         |         |         |
 5786 - 5845 FIDNIFRFTQAGSEVSALLGRIPSAVGYQPNLATEMGALQERITSTKSGSITSVQAVYVP
( 241)-( 300)
              5850      5860      5870      5880      5890      5900
                 |         |         |         |         |         |
 5846 - 5905 ADDLTDPAPATTFSHLDATTVLSRNIASLGIYPAVDPLDSTSKALSEDVVGKEHYEVARK
( 301)-( 360)
              5910      5920      5930      5940      5950      5960
                 |         |         |         |         |         |
 5906 - 5965 VQEVLQRYKELQDIIAILGMDELSDEDKLTVSRARKIERFFSQPFSVAEQFTGMEGKYVP
( 361)-( 420)
              5970      5980      5990      6000
                 |         |         |         |
 5966 - 6005 VKETIRGFREILEGKHDDIPEQAFLYVGTIEEAVAKSKDL
( 421)-( 460)
              6010      6020      6030      6040      6050      6060
                 |         |         |         |         |         |
 6006 - 6065 PGMKEIKSRIKSVQSTRQITNAMEIVSTTKFKRYSKLVTESRPYEESMRKILGNIASGVK
(   2)-(  61)
              6070      6080      6090      6100      6110      6120
                 |         |         |         |         |         |
 6066 - 6125 NEGHPLFDGRKEVKSIAIIVITSDRGLCGSFNSSTLKELEKLVEKNKNKNITIIPFGRKA
(  62)-( 121)
              6130      6140      6150      6160      6170      6180
                 |         |         |         |         |         |
 6126 - 6185 IDFITKRNYEFSESFSKISPDEMNKIAGEISEEVVEKYNNHIYDEVYVIYNKFISALRYD
( 122)-( 181)
              6190      6200      6210      6220      6230      6240
                 |         |         |         |         |         |
 6186 - 6245 LTCERIIPITRPEVELNSEYIFEPSTEYILSALLPRFINLQIYQAILNNTASEHSARKNS
( 182)-( 241)
              6250      6260      6270      6280
                 |         |         |         |
 6246 - 6286 MSSATDNADEMIKTLNIKYNRNRQSAITQEITEIVGGASAL
( 242)-( 282)
             6290      6300      6310      6320      6330      6340
                |         |         |         |         |         |
 6287 - 6346 MPSFDVSVVTQVKKILEQEAGYLRLRTSEGDIGILPNHAPFVAELSMGKMEIESPNKDRR
(   1)-(  60)
             6350      6360      6370      6380      6390      6400
                |         |         |         |         |         |
 6347 - 6406 DIYFLSGGFLEISDNQATVIADEVFPIEKIDVESEQALVENLKKELEKVSTEEEKRKLQK
(  61)-( 120)
             6410      6420
                |         |
 6407 - 6420 KIKISLAKIDAKNN
( 121)-( 134)
 
 
 
 
# 51 # Note: No rounded coordinates detected
No significant rounding of atom coordinates has been detected.
 
# 52 # Warning: Artificial side chains detected
At least two residues (listed in the table below) were detected with chi-1
equal to 0.00 or 180.00. Since this is highly unlikely to occur accidentally,
the listed residues have probably not been refined.
 
 3458 HIS  ( 266-) I  -
 6141 SER  ( 137-) O  -
 6186 LEU  ( 182-) O  -
 
# 53 # Note: No missing atoms detected in residues
All expected atoms are present in residues. This validation option has not
looked at 'things' that can or should be attached to the elementary building
blocks (amino acids, nucleotides). Even the C-terminal oxygens are treated
separately.
 
# 54 # Warning: B-factors outside the range 0.0 - 100.0
In principle, B-factors can have a very wide range of values, but in
practice, B-factors should not be zero while B-factors above 100.0
are a good indicator that the location of that atom is meaningless. Be
aware that the cutoff at 100.0 is arbitrary. 'High' indicates that atoms
with a B-factor > 100.0 were observed; 'Zero' indicates that atoms with
a B-factor of zero were observed.
 
   96 GLU  ( 120-) A  -   High
  100 ASP  ( 124-) A  -   High
  101 LYS  ( 125-) A  -   High
  106 GLU  ( 130-) A  -   High
  147 ARG  ( 171-) A  -   High
  272 ARG  ( 296-) A  -   High
  301 ASP  ( 325-) A  -   High
  323 GLN  ( 347-) A  -   High
  357 LYS  ( 381-) A  -   High
  367 GLU  ( 391-) A  -   High
  397 LYS  ( 421-) A  -   High
  445 ASN  ( 469-) A  -   High
  757 GLU  ( 307-) B  -   High
  797 GLN  ( 347-) B  -   High
  815 ARG  ( 365-) B  -   High
And so on for a total of   222 lines.
 
# 55 # Note: C-terminus capping
The residues listed in the table below are either C-terminal or pseudo
C-terminal (i.e. last residue before a missing residue).
In X-ray the coordinates must be located in density. Mobility or disorder
sometimes cause this density to be so poor that the positions of the atoms
cannot be determined. Crystallographers tend to leave out the atoms in such
cases. In many cases the N- or C-terminal residues are too disordered to see.
In case of the N-terminus, you can often see from the residue numbers if
there are missing residues; at the C-terminus this is impossible. Therefore,
often the position of the backbone nitrogen of the first residue missing
at the C-terminal end is calculated and added to indicate that there
are missing residues. As a single N causes validation trouble, we remove
these single-N-residues before doing the validation. If this happened,
the label -N is added to the pseudo C-terminus. Other labels can be +X
in case something weird is bound to the backbone C, or +OXT if a spurious
OXT atom is found. -OXT indicates that an expected OXT is missing. 'Swap'
means that the O' and O'' (O and OXT in PDB files) have been swapped in
terms of nomenclature. 'Bad' means that something bad happened that WHAT IF
does not understand. In such cases you might get three residue numbers in
square brackets; one of those might be what WHAT IF had expected to find,
but then it also might not). In case of chain breaks the number of missing
residues is listen in round brackets. OK means what it suggests...
 
Be aware that we cannot easily see the difference between these errors and
errors in the chain and residue numbering schemes. So do not blindly trust
the table below. If you get weird errors at, or near, the left-over
incomplete C-terminal residue, please check by hand if a missing Oxt or
a removed single N is the cause. Also, many peptidic ligands get the same
chain identifier as the larger protein they are bound to. In such cases there
are more than one C-termini and OXTs with the same ID. WHAT IF gives some
random warnings about these cases. So, don't take everything at face value,
but think for yourself.
 
  476 ASN  ( 500-) A  -        +OXT [ 476 ; 476 ; 500]
  950 ASN  ( 500-) B  -        +OXT [ 950 ; 476 ; 500]
 1323 GLN  ( 397-) C  -        OK (5)
 1421 ASN  ( 500-) C  -        +OXT [1421 ; 476 ; 500]
 1881 LEU  ( 460-) D  -        OK
 2341 LEU  ( 460-) E  -        OK
 2803 LYS  ( 462-) F  -        +OXT [2803 ; 476 ; 462]
 3084 LEU  ( 282-) G  -        +OXT [3084 ; 476 ; 282]
 3218 ASN  ( 134-) H  -        +OXT [3218 ; 476 ; 134]
 3692 ASN  ( 500-) I  -        +OXT [3692 ; 476 ; 500]
 4064 GLN  ( 397-) J  -        OK (6)
 4161 ASN  ( 500-) J  -        +OXT [4161 ; 476 ; 500]
 4535 SER  ( 400-) K  -        OK (3)
 4627 PHE  ( 495-) K  -        OK
 5086 LEU  ( 460-) L  -        OK
 5545 LEU  ( 460-) M  -        OK
 6005 LEU  ( 460-) N  -        OK
 6286 LEU  ( 282-) O  -        +OXT [6286 ; 476 ; 282]
 6420 ASN  ( 134-) P  -        +OXT [6420 ; 476 ; 134]
 
# 56 # Note: Weights administratively correct
All atomic occupancy factors ('weights') fall in the 0.0--1.0 range, which
makes them administratively correct.
 
# 57 # Note: Normal distribution of occupancy values
 
The distribution of the occupancy values in this file seems 'normal'.
 
Be aware that this evaluation is merely the result of comparing this file
with about 500 well-refined high-resolution files in the PDB. If this file
has much higher or much lower resolution than the PDB files used
in WHAT CHECK's training set, non-normal values might very well be perfectly
fine, or normal values might actually be not so normal. So, this check is
actually more an indicator and certainly not a check in which I have great
confidence.
 
# 58 # Note: All occupancies seem to add up to 0.0 - 1.0.
In principle, the occupancy of all alternates of one atom should add up till
0.0 - 1.0. 0.0 is used for the missing atom (i.e. an atom not seen in the
electron density). Obviously, there is nothing terribly wrong when a few
occupancies add up to a bit more than 1.0, because the mathematics of
refinement allow for that. However, if it happens often, it seems worth
evaluating this in light of the refinement protocol used.
 
# 59 # Warning: What type of B-factor?
WHAT CHECK does not yet know well how to cope with B-factors in case TLS has
been used. It simply assumes that the B-factor listed on the ATOM and HETATM
cards are the total B-factors. When TLS refinement is used that assumption
sometimes is not correct. The header of the PDB file states that TLS groups
were used. So, if WHAT CHECK complains about your  B-factors, while you think
that they are OK, then check for TLS related B-factor problems first.
 
Number of TLS groups mentione in PDB file header: 16
 
Temperature not mentioned in PDB file. This most likely means
that the temperature record is absent.
Room temperature assumed
 
# 60 # Note: Number of buried atoms with low B-factor is OK
For protein structures determined at room temperature, no more than about 1
percent of the B factors of buried atoms is below 5.0. In liquid
nitrogen this percentage is allowed to be higher, of course.
 
Percentage of buried atoms with B less than 5 :   0.00
 
# 61 # Note: B-factor distribution normal
The distribution of B-factors within residues is within expected ranges.
A value over 1.5 here would mean that the B-factors show signs of
over-refinement.
 
RMS Z-score :  1.108 over   43201 bonds
Average difference in B over a bond :    3.37
RMS difference in B over a bond :    4.81
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
 
# 62 # Note: B-factor plot
The average atomic B-factor per residue is plotted as function of the residue
number.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: A
 
# 63 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: B
 
# 64 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: C
 
# 65 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: D
 
# 66 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: E
 
# 67 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: F
 
# 68 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: G
 
# 69 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: H
 
# 70 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: I
 
# 71 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: J
 
# 72 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: K
 
# 73 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: L
 
# 74 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: M
 
# 75 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: N
 
# 76 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: O
 
# 77 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: P
 
# 78 # Note: Introduction to the nomenclature section.
Nomenclature problems seem, at first, rather unimportant. After all who
cares if we call the delta atoms in leucine delta2 and delta1 rather than
the other way around. Chemically speaking that is correct. But structures
have not been solved and deposited just for chemists to look at them. Most
times a structure is used, it is by software in a bioinformatics lab. And
if they compare structures in which the one used C delta1 and delta2 and the
other uses C delta2 and delta1, then that comparison will fail. Also, we
recalculate all structures every so many years to make sure that everybody
always can get access to the best coordinates that can be obtained from
the (your?) experimental data. These recalculations will be troublesome if
there are nomenclature problems.
 
Several nomenclature problems actually are worse than that. At the
WHAT CHECK website [REF] you can get an overview of the importance of all
nomenclature problems that we list.
 
# 79 # Note: Valine nomenclature OK
No errors were detected in valine nomenclature.
 
# 80 # Note: Threonine nomenclature OK
No errors were detected in threonine nomenclature.
 
# 81 # Note: Isoleucine nomenclature OK
No errors were detected in isoleucine nomenclature.
 
# 82 # Note: Leucine nomenclature OK
No errors were detected in leucine nomenclature.
 
# 83 # Note: Arginine nomenclature OK
No errors were detected in arginine nomenclature.
 
# 84 # Note: Tyrosine torsion conventions OK
No errors were detected in tyrosine torsion angle conventions.
 
# 85 # Note: Phenylalanine torsion conventions OK
No errors were detected in phenylalanine torsion angle conventions.
 
# 86 # Note: Aspartic acid torsion conventions OK
No errors were detected in aspartic acid torsion angle conventions.
 
# 87 # Note: Glutamic acid torsion conventions OK
No errors were detected in glutamic acid torsion angle conventions.
 
# 88 # Note: Phosphate group names OK in DNA/RNA
No errors were detected in nucleic acid phosphate group naming conventions
(or this structure contains no nucleic acids).
 
# 89 # Note: Heavy atom naming OK
No errors were detected in the atom names for non-hydrogen atoms. Please
be aware that the PDB wants us to deliberately make some nomenclature errors;
especially in non-canonical amino acids.
 
# 90 # Note: No decreasing residue numbers
All residue numbers are strictly increasing within each chain.
 
# 91 # Warning: Unusual bond lengths
The bond lengths listed in the table below were found to deviate more than 4
sigma from standard bond lengths (both standard values and sigmas for amino
acid residues have been taken from Engh and Huber [REF], for DNA they were
taken from Parkinson et al [REF]). In the table below for each unusual bond
the bond length and the number of standard deviations it differs from the
normal value is given.
 
Atom names starting with "-" belong to the previous residue in the chain. If
the second atom name is "-SG*", the disulphide bridge has a deviating length.
 
   91 ILE  ( 115-) A  -    CG1  CD1   2.04   13.4
  112 ILE  ( 136-) A  -    CG1  CD1   1.32   -5.0
  113 ILE  ( 137-) A  -    CG1  CD1   1.68    4.4
  156 ILE  ( 180-) A  -    CG1  CD1   1.34   -4.4
  160 ILE  ( 184-) A  -    CG1  CD1   1.34   -4.3
  184 ILE  ( 208-) A  -    CG1  CD1   1.77    6.6
  238 ASP  ( 262-) A  -    CG   OD2   1.34    4.7
  306 ILE  ( 330-) A  -    CG1  CD1   1.24   -7.0
  395 ILE  ( 419-) A  -    CG1  CD1   1.34   -4.4
  476 ASN  ( 500-) A  -    CA   CB    1.62    4.4
  488 ILE  (  38-) B  -    CG1  CD1   1.35   -4.1
  514 LEU  (  64-) B  -    CB   CG    1.43   -4.9
  586 ILE  ( 136-) B  -    CG1  CD1   1.88    9.4
  951 ILE  (  25-) C  -    CG1  CD1   1.73    5.6
  979 LEU  (  53-) C  -    CG   CD1   1.39   -4.0
And so on for a total of    80 lines.
 
# 92 # Note: Normal bond length variability
Bond lengths were found to deviate normally from the standard bond lengths
(values for Protein residues were taken from Engh and Huber [REF], for
DNA/RNA from Parkinson et al [REF]).
 
 RMS Z-score for bond lengths: 0.656
 RMS-deviation in bond distances: 0.018
 
# 93 # Warning: Possible cell scaling problem
Comparison of bond distances with Engh and Huber [REF] standard values for
protein residues and Parkinson et al [REF] values for DNA/RNA shows a
significant systematic deviation. It could be that the unit cell used in
refinement was not accurate enough. The deformation matrix given below gives
the deviations found: the three numbers on the diagonal represent the
relative corrections needed along the A, B and C cell axis. These values are
1.000 in a normal case, but have significant deviations here (significant at
the 99.99 percent confidence level)
 
There are a number of different possible causes for the discrepancy. First
the cell used in refinement can be different from the best cell calculated.
Second, the value of the wavelength used for a synchrotron data set can be
miscalibrated. Finally, the discrepancy can be caused by a dataset that has
not been corrected for significant anisotropic thermal motion.
 
Please note that the proposed scale matrix has NOT been restrained to obey
the space group symmetry. This is done on purpose. The distortions can give
you an indication of the accuracy of the determination.
 
If you intend to use the result of this check to change the cell dimension
of your crystal, please read the extensive literature on this topic first.
This check depends on the wavelength, the cell dimensions, and on the
standard bond lengths and bond angles used by your refinement software.
 
SCALE matrix obtained from PDB file
  0.008933  0.000000  0.001931
  0.000000  0.004995  0.000000
  0.000000  0.000000  0.005072
Unit Cell deformation matrix
  1.000419 -0.000024  0.000398
 -0.000024  1.000789 -0.000043
  0.000398 -0.000043  1.000500
Proposed new scale matrix
  0.008929  0.000000  0.001927
  0.000000  0.004991  0.000000
 -0.000002  0.000000  0.005069
With corresponding cell
    A    = 111.987  B   = 200.367  C    = 201.792
    Alpha=  90.000  Beta= 102.155  Gamma=  90.000
 
The CRYST1 cell dimensions
    A    = 111.940  B   = 200.209  C    = 201.725
    Alpha=  90.000  Beta= 102.200  Gamma=  90.000
 
 Variance: 75.487
 (Under-)estimated Z-score: 6.403
 
# 94 # Warning: Unusual bond angles
The bond angles listed in the table below were found to deviate more than 4
sigma from standard bond angles (both standard values and sigma for protein
residues have been taken from Engh and Huber [REF], for DNA/RNA from
Parkinson et al [REF]). In the table below for each strange angle the bond
angle and the number of standard deviations it differs from the standard
values is given. Please note that disulphide bridges are neglected. Atoms
starting with "-" belong to the previous residue in the sequence.
 
    1 ILE  (  25-) A  -    N    CA   CB  102.43   -4.7
    1 ILE  (  25-) A  -    C    CA   CB  121.16    5.8
   14 ILE  (  38-) A  -    CB   CG1  CD1 104.56   -4.4
   31 PHE  (  55-) A  -    CA   CB   CG  119.47    5.7
   62 ASP  (  86-) A  -    CA   CB   CG  116.69    4.1
  105 ILE  ( 129-) A  -    N    CA   CB  117.41    4.1
  106 GLU  ( 130-) A  -    CB   CG   CD  124.62    7.1
  113 ILE  ( 137-) A  -    N    CA   CB  103.49   -4.1
  157 ASP  ( 181-) A  -    CA   CB   CG  119.99    7.4
  166 ASP  ( 190-) A  -    CA   CB   CG  118.27    5.7
  195 ASP  ( 219-) A  -    CA   CB   CG  120.01    7.4
  211 GLN  ( 235-) A  -    CG   CD   NE2 110.34   -4.0
  231 HIS  ( 255-) A  -    CA   CB   CG  109.47   -4.3
  237 ASP  ( 261-) A  -    CA   CB   CG  118.11    5.5
  238 ASP  ( 262-) A  -    CA   CB   CG  116.95    4.3
And so on for a total of   287 lines.
 
# 95 # Note: Normal bond angle variability
Bond angles were found to deviate normally from the mean standard bond angles
(normal values for protein residues were taken from Engh and Huber [REF], for
DNA/RNA from Parkinson et al [REF]). The RMS Z-score given below is expected
to be near 1.0 for a normally restrained data set, and this is indeed
observed for very high resolution X-ray structures.
 
 RMS Z-score for bond angles: 0.940
 RMS-deviation in bond angles: 1.762
 
# 96 # Note: Residue hand check OK
No atoms are observed that have the wrong handedness. Be aware, though, that
WHAT CHECK might have corrected the handedness of some atoms already. The
handedness has not been corrected for any case where the problem is worse
than just an administrative discomfort.
 
# 97 # Warning: Chirality deviations detected
The atoms listed in the table below have an improper dihedral value
that is deviating from expected values. As the improper dihedral values
are all getting very close to ideal values in recent X-ray structures,
and as we actually do not know how big the spread around these values
should be, this check only warns for 6 sigma deviations.
 
Improper dihedrals are a measure of the chirality/planarity of the structure
at a specific atom. Values around -35 or +35 are expected for chiral atoms,
and values around 0 for planar atoms. Planar side chains are left out of the
calculations, these are better handled by the planarity checks.
 
Three numbers are given for each atom in the table. The first is the Z-score
for the improper dihedral. The second number is the measured improper
dihedral. The third number is the expected value for this atom type. A final
column contains an extra warning if the chirality for an atom is opposite
to the expected value.
 
  309 ASN  ( 333-) A  -    CA    -6.3    22.24    33.59
  315 ASP  ( 339-) A  -    C      7.3    11.03     0.05
 1448 ASN  (  27-) D  -    CA    -6.7    21.65    33.59
 4653 ASN  (  27-) L  -    CA    -6.7    21.56    33.59
The average deviation= 1.008
 
# 98 # Note: Improper dihedral angle distribution OK
The RMS Z-score for all improper dihedrals in the structure is within normal
ranges.
 
 Improper dihedral RMS Z-score : 0.881
 
# 99 # Note: Tau angles OK
All of the tau angles (N-C-alpha-C) of amino acids fall within expected
RMS deviations.
 
# 100 # Note: Normal tau angle deviations
The RMS Z-score for the tau angles (N-C-alpha-C) in the structure falls
within the normal range that we guess to be 0.5 - 1.5. Be aware, we
determined the tau normal distributions from 500 high-resolution X-ray
structures, rather than from CSD data, so we cannot be 100 percent certain
about these numbers.
 
 Tau angle RMS Z-score : 0.907
 
# 101 # Error: Side chain planarity problems
The side chains of the residues listed in the table below contain a planar
group that was found to deviate from planarity by more than 4.0 times the
expected value. For an amino acid residue that has a side chain with a
planar group, the RMS deviation of the atoms to a least squares plane was
determined. The number in the table is the number of standard deviations
this RMS value deviates from the expected value. Not knowing better yet, we
assume that planarity of the groups analyzed should be perfect.
 
 2873 ARG  (  71-) G  -   7.67
 6075 ARG  (  71-) O  -   7.54
  309 ASN  ( 333-) A  -   6.84
 3525 ASN  ( 333-) I  -   6.44
 2981 ARG  ( 179-) G  -   6.37
 6183 ARG  ( 179-) O  -   6.28
 2150 GLN  ( 269-) E  -   6.22
 4489 ARG  ( 354-) K  -   6.02
 3546 ARG  ( 354-) I  -   5.95
  330 ARG  ( 354-) A  -   5.66
 5354 GLN  ( 269-) M  -   5.40
 6221 ARG  ( 217-) O  -   5.36
 1204 ARG  ( 278-) C  -   5.21
 1448 ASN  (  27-) D  -   5.10
 4413 ARG  ( 278-) K  -   5.05
And so on for a total of    50 lines.
 
# 102 # Note: Atoms connected to aromatic rings OK
All of the atoms that are connected to planar aromatic rings in side chains
of amino-acid residues are in the plane within expected RMS deviations.
Since there is no DNA and no protein with hydrogens, no uncalibrated
planarity check was performed.
 
# 103 # Warning: Ramachandran Z-score low
The score expressing how well the backbone conformations of all residues
correspond to the known allowed areas in the Ramachandran plot is a bit low.
 
 Ramachandran Z-score : -3.917
 
# 104 # Note: Ramachandran check
The list contains per-residue Z-scores describing how well each residue
fits into the allowed areas of the Ramachandran plot will not be printed
because WHAT CHECK found no reason to cry.
 
# 105 # Warning: Torsion angle evaluation shows unusual residues
The residues listed in the table below contain bad or abnormal
torsion angles.
 
These scores give an impression of how `normal' the torsion angles in
protein residues are. All torsion angles except omega are used for
calculating a `normality' score. Average values and standard deviations were
obtained from the residues in the WHAT CHECK database. These are used to
calculate Z-scores. A residue with a Z-score of below -2.0 is poor, and a
score of less than -3.0 is worrying. For such residues more than one torsion
angle is in a highly unlikely position.
 
 4749 THR  ( 123-) L  -   -3.6
 1544 THR  ( 123-) D  -   -3.6
 3694 THR  (  27-) J  -   -2.9
 5208 THR  ( 123-) M  -   -2.9
 6140 PHE  ( 136-) O  -   -2.9
 3007 PRO  ( 205-) G  -   -2.9
 2351 ILE  (  10-) F  -   -2.7
 2147 VAL  ( 266-) E  -   -2.7
 5351 VAL  ( 266-) M  -   -2.7
 1687 VAL  ( 266-) D  -   -2.7
 4892 VAL  ( 266-) L  -   -2.7
 3097 LYS  (  13-) H  -   -2.7
 5555 ILE  (  10-) N  -   -2.6
 5258 ILE  ( 173-) M  -   -2.6
 6299 LYS  (  13-) P  -   -2.6
And so on for a total of   233 lines.
 
# 106 # Warning: Backbone evaluation reveals unusual conformations
The residues listed in the table below have abnormal backbone torsion
angles.
 
Residues with `forbidden' phi-psi combinations are listed, as well as
residues with unusual omega angles (deviating by more than 3 sigma from the
normal value). Please note that it is normal if about 5 percent of the
residues is listed here as having unusual phi-psi combinations.
 
    4 SER  (  28-) A  - omega poor
   11 GLY  (  35-) A  - Poor phi/psi
   13 GLY  (  37-) A  - Poor phi/psi
   19 GLY  (  43-) A  - Poor phi/psi
   26 GLY  (  50-) A  - Poor phi/psi
   31 PHE  (  55-) A  - Omega to (next) Pro poor
   53 GLY  (  77-) A  - Poor phi/psi, omega poor
   61 GLY  (  85-) A  - Poor phi/psi
   68 GLY  (  92-) A  - Poor phi/psi
   69 LYS  (  93-) A  - omega poor
   73 VAL  (  97-) A  - Omega to (next) Pro poor
   76 GLY  ( 100-) A  - Poor phi/psi
   81 GLY  ( 105-) A  - Poor phi/psi
   88 GLY  ( 112-) A  - Poor phi/psi
   89 ASP  ( 113-) A  - Omega to (next) Pro poor
And so on for a total of   941 lines.
 
# 107 # Error: Chi-1/chi-2 rotamer problems
List of residues with a poor chi-1/chi-2 combination. Be aware that for this
validation option the individual scores are far less important than the
overall score that is given below the table.
 
    8 LEU  (  32-) A  -    -1.32
   40 LEU  (  64-) A  -    -1.32
   52 LEU  (  76-) A  -    -1.32
  122 LEU  ( 146-) A  -    -1.32
  273 LEU  ( 297-) A  -    -1.31
  362 LEU  ( 386-) A  -    -1.32
  368 LEU  ( 392-) A  -    -1.31
  369 LEU  ( 393-) A  -    -1.31
  440 LEU  ( 464-) A  -    -1.32
  482 LEU  (  32-) B  -    -1.32
  531 LEU  (  81-) B  -    -1.30
  596 LEU  ( 146-) B  -    -1.32
  747 LEU  ( 297-) B  -    -1.31
  836 LEU  ( 386-) B  -    -1.32
  842 LEU  ( 392-) B  -    -1.31
And so on for a total of  3351 lines.
 
# 108 # Error: chi-1/chi-2 angle correlation Z-score very low
The score expressing how well the chi-1/chi-2 angles of all residues
correspond to the populated areas in the database is
very low.
 
 chi-1/chi-2 correlation Z-score : -5.797
 
# 109 # Warning: Unusual rotamers
The residues listed in the table below have a rotamer that is not seen very
often in the database of solved protein structures. This option determines
for every residue the position specific chi-1 rotamer distribution.
Thereafter it verified whether the actual residue in the molecule has the
most preferred rotamer or not. If the actual rotamer is the preferred one,
the score is 1.0. If the actual rotamer is unique, the score is 0.0. If
there are two preferred rotamers, with a population distribution of 3:2 and
your rotamer sits in the lesser populated rotamer, the score will be 0.667.
No value will be given if insufficient hits are found in the database.
 
It is not necessarily an error if a few residues have rotamer values below
0.3, but careful inspection of all residues with these low values could be
worth it.
 
 5885 SER  ( 340-) N  -   0.33
  812 SER  ( 362-) B  -   0.33
 1813 SER  ( 392-) D  -   0.35
 2273 SER  ( 392-) E  -   0.35
 5477 SER  ( 392-) M  -   0.35
 6052 SER  (  48-) O  -   0.35
 2743 SER  ( 402-) F  -   0.35
  288 SER  ( 312-) A  -   0.35
 4906 GLN  ( 280-) L  -   0.36
 2269 LYS  ( 388-) E  -   0.36
  412 SER  ( 436-) A  -   0.36
 1357 SER  ( 436-) C  -   0.36
 1773 LYS  ( 352-) D  -   0.36
 2850 SER  (  48-) G  -   0.36
 3628 SER  ( 436-) I  -   0.36
And so on for a total of    50 lines.
 
# 110 # Warning: Unusual backbone conformations
For the residues listed in the table below, the backbone formed by itself and
two neighbouring residues on either side is in a conformation that is not
seen very often in the database of solved protein structures. The number
given in the table is the number of similar backbone conformations in the
database with the same amino acid in the centre.
 
For this check, backbone conformations are compared with database structures
using C-alpha superpositions with some restraints on the backbone oxygen
positions.
 
A residue mentioned in the table can be part of a strange loop, or there
might be something wrong with it or its directly surrounding residues. There
are a few of these in every protein, but in any case it is worth looking at,
especially if a regular DSSP secondary structure (H or S for helix or strand,
respectively) is indicated!
 
   20 LEU  (  44-) A  -       0
  132 MET  ( 156-) A  -       0
  149 THR  ( 173-) A  -       0
  165 GLN  ( 189-) A  -       0
  237 ASP  ( 261-) A  -       0
  238 ASP  ( 262-) A  -       0
  259 ARG  ( 283-) A  -       0
  332 ALA  ( 356-) A  -       0
  378 LEU  ( 402-) A  -       0
  379 ASP  ( 403-) A  -       0
  494 LEU  (  44-) B  -       0
  545 VAL  (  95-) B  -       0
  606 MET  ( 156-) B  -       0
  623 THR  ( 173-) B  -       0
  711 ASP  ( 261-) B  -       0
And so on for a total of   212 lines.
 
# 111 # Note: Backbone conformation Z-score OK
The backbone conformation analysis gives a score that is normal for well
refined protein structures.
 
 Backbone conformation Z-score : -0.114
 
# 112 # Warning: Omega angle restraints not strong enough
The omega angles for trans-peptide bonds in a structure is expected to give
a gaussian distribution with the average around +178 degrees, and a standard
deviation around 5.5. In the current structure the standard deviation of
this distribution is above 7.0, which indicates that the omega values have
been under-restrained.
 
Omega average and std. deviation= 179.760 7.137
 
# 113 # Warning: Unusual PRO puckering amplitudes
The proline residues listed in the table below have a puckering amplitude
that is outside of normal ranges. Puckering parameters were calculated by
the method of Cremer and Pople [REF]. Normal PRO rings have a puckering
amplitude Q between 0.20 and 0.45 Angstrom. If Q is lower than 0.20 Angstrom
for a PRO residue, this could indicate disorder between the two different
normal ring forms (with C-gamma below and above the ring, respectively). If
Q is higher than 0.45 Angstrom something could have gone wrong during the
refinement. Be aware that this is a warning with a low confidence level. See:
Who checks the checkers? Four validation tools applied to eight atomic
resolution structures [REF]
 
  403 PRO  ( 427-) A  -   0.19 LOW
  877 PRO  ( 427-) B  -   0.18 LOW
 1348 PRO  ( 427-) C  -   0.14 LOW
 1499 PRO  (  78-) D  -   0.07 LOW
 1535 PRO  ( 114-) D  -   0.11 LOW
 1825 PRO  ( 404-) D  -   0.20 LOW
 1959 PRO  (  78-) E  -   0.04 LOW
 1995 PRO  ( 114-) E  -   0.10 LOW
 2285 PRO  ( 404-) E  -   0.17 LOW
 2415 PRO  (  74-) F  -   0.18 LOW
 2419 PRO  (  78-) F  -   0.05 LOW
 2455 PRO  ( 114-) F  -   0.07 LOW
 2641 PRO  ( 300-) F  -   0.14 LOW
 2745 PRO  ( 404-) F  -   0.19 LOW
 4559 PRO  ( 427-) K  -   0.16 LOW
 4704 PRO  (  78-) L  -   0.06 LOW
 4740 PRO  ( 114-) L  -   0.13 LOW
 5030 PRO  ( 404-) L  -   0.19 LOW
 5159 PRO  (  74-) M  -   0.18 LOW
 5163 PRO  (  78-) M  -   0.09 LOW
 5199 PRO  ( 114-) M  -   0.07 LOW
 5489 PRO  ( 404-) M  -   0.15 LOW
 5623 PRO  (  78-) N  -   0.05 LOW
 5659 PRO  ( 114-) N  -   0.11 LOW
 5845 PRO  ( 300-) N  -   0.11 LOW
 5949 PRO  ( 404-) N  -   0.18 LOW
 6006 PRO  (   2-) O  -   0.16 LOW
 
# 114 # Warning: Unusual PRO puckering phases
The proline residues listed in the table below have a puckering phase that is
not expected to occur in protein structures. Puckering parameters were
calculated by the method of Cremer and Pople [REF]. Normal PRO rings
approximately show a so-called envelope conformation with the C-gamma atom
above the plane of the ring (phi=+72 degrees), or a half-chair conformation
with C-gamma below and C-beta above the plane of the ring (phi=-90 degrees).
If phi deviates strongly from these values, this is indicative of a very
strange conformation for a PRO residue, and definitely requires a manual
check of the data. Be aware that this is a warning with a low confidence
level. See: Who checks the checkers? Four validation tools applied to eight
atomic resolution structures [REF].
 
   90 PRO  ( 114-) A  -  -51.2 half-chair C-beta/C-alpha (-54 degrees)
  104 PRO  ( 128-) A  -  -59.4 half-chair C-beta/C-alpha (-54 degrees)
  256 PRO  ( 280-) A  - -113.2 envelop C-gamma (-108 degrees)
  331 PRO  ( 355-) A  -   48.8 half-chair C-delta/C-gamma (54 degrees)
  564 PRO  ( 114-) B  -  -49.3 half-chair C-beta/C-alpha (-54 degrees)
  578 PRO  ( 128-) B  -  -59.1 half-chair C-beta/C-alpha (-54 degrees)
  730 PRO  ( 280-) B  - -112.2 envelop C-gamma (-108 degrees)
  873 PRO  ( 423-) B  -  -62.2 half-chair C-beta/C-alpha (-54 degrees)
 1040 PRO  ( 114-) C  -  -51.7 half-chair C-beta/C-alpha (-54 degrees)
 1054 PRO  ( 128-) C  -  -60.6 half-chair C-beta/C-alpha (-54 degrees)
 1344 PRO  ( 423-) C  -  -65.4 envelop C-beta (-72 degrees)
 1495 PRO  (  74-) D  -  104.6 envelop C-beta (108 degrees)
 1515 PRO  (  94-) D  -  -34.9 envelop C-alpha (-36 degrees)
 1634 PRO  ( 213-) D  -   52.4 half-chair C-delta/C-gamma (54 degrees)
 1728 PRO  ( 307-) D  -  101.3 envelop C-beta (108 degrees)
And so on for a total of    45 lines.
 
# 115 # Warning: Backbone oxygen evaluation
The residues listed in the table below have an unusual backbone oxygen
position.
 
For each of the residues in the structure, a search was performed to find
5-residue stretches in the WHAT CHECK database with superposable C-alpha
coordinates, and some restraints on the neighbouring backbone oxygens.
 
In the following table the RMS distance between the backbone oxygen positions
of these matching structures in the database and the position of the backbone
oxygen atom in the current residue is given. If this number is larger than
1.5 a significant number of structures in the database show an alternative
position for the backbone oxygen. If the number is larger than 2.0 most
matching backbone fragments in the database have the peptide plane flipped.
A manual check needs to be performed to assess whether the experimental data
can support that alternative as well. The number in the last column is the
number of database hits (maximum 80) used in the calculation. It is "normal"
that some glycine residues show up in this list, but they are still worth
checking!
 
 4751 ILE  ( 125-) L  -  1.70   80
 2466 ILE  ( 125-) F  -  1.66   80
 5670 ILE  ( 125-) N  -  1.65   80
 3798 ARG  ( 131-) J  -  1.62   10
 1546 ILE  ( 125-) D  -  1.61   80
 1803 GLU  ( 382-) D  -  1.60   18
 5467 GLU  ( 382-) M  -  1.57   16
 2263 GLU  ( 382-) E  -  1.56   17
 5008 GLU  ( 382-) L  -  1.56   16
 4804 GLY  ( 178-) L  -  1.56   44
 5725 GLY  ( 180-) N  -  1.55   10
 5723 GLY  ( 178-) N  -  1.54   44
  107 ARG  ( 131-) A  -  1.54   10
 2519 GLY  ( 178-) F  -  1.53   45
 4806 GLY  ( 180-) L  -  1.52   12
 5074 GLY  ( 448-) L  -  1.52   13
 1601 GLY  ( 180-) D  -  1.52   11
 1599 GLY  ( 178-) D  -  1.52   41
 1869 GLY  ( 448-) D  -  1.50   12
 
# 116 # Warning: Possible peptide flips
For the residues listed in the table below, the backbone formed by the
residue mentioned and the one N-terminal of it show systematic deviations
from normality that are consistent with a peptide flip. This can either
be a 180 degree flip of the entire peptide plane or a trans to cis flip.
(Cis to trans flips cannot be detected yet). The type can be TT+, TC-,
or TC+:
TT+ indicates a 180 degree flip of the entire peptide plane.
TC- indicates a trans to cis conversion that requires a flip of the N atom.
TC+ indicates a trans to cis conversion that requires a flip of the O atom.
Note that the method will only work correctly for PDB files with full
isotropic B-factors.
 
  379 ASP  ( 403-) A  - TT+   Likely
  496 ASN  (  46-) B  - TT+   Likely
  845 PHE  ( 395-) B  - TT+   Likely
 1215 ASP  ( 289-) C  - TT+   Likely
 1249 ALA  ( 323-) C  - TT+   Likely
 1305 ALA  ( 379-) C  - TT+   Likely
 1456 ASP  (  35-) D  - TT+   Likely
 1857 HIS  ( 436-) D  - TT+   Likely
 2032 ALA  ( 151-) E  - TT+   Likely
 2376 ASP  (  35-) F  - TT+   Likely
 2464 THR  ( 123-) F  - TT+   Likely
 2777 HIS  ( 436-) F  - TT+   Likely
 2862 VAL  (  60-) G  - TT+   Likely
 2874 LYS  (  72-) G  - TT+   Likely
 2893 SER  (  91-) G  - TT+   Likely
 2931 ASN  ( 129-) G  - TT+   Likely
 3571 ALA  ( 379-) I  - TT+   Likely
 3590 PHE  ( 398-) I  - TT+   Likely
 3595 ASP  ( 403-) I  - TT+   Likely
 3703 ASP  (  36-) J  - TT+   Likely
 4046 ALA  ( 379-) J  - TT+   Likely
 4661 ASP  (  35-) L  - TT+   Likely
 5008 GLU  ( 382-) L  - TT+   Likely
 5222 ALA  ( 137-) M  - TT+   Likely
 5236 ALA  ( 151-) M  - TT+   Likely
 5580 ASP  (  35-) N  - TT+   Likely
 5594 ASN  (  49-) N  - TT+   Likely
 5643 GLN  (  98-) N  - TT+   Likely
 5668 THR  ( 123-) N  - TT+   Likely
 6064 VAL  (  60-) O  - TT+   Likely
 
# 117 # Error: Abnormally short interatomic distances
The pairs of atoms listed in the table below have an unusually short
interactomic distance; each bump is listed in only one direction.
 
The contact distances of all atom pairs have been checked. Two atoms are
said to `bump' if they are closer than the sum of their Van der Waals radii
minus 0.40 Angstrom. For hydrogen bonded pairs a tolerance of 0.55 Angstrom
is used. The first number in the table tells you how much shorter that
specific contact is than the acceptable limit. The second distance is the
distance between the centres of the two atoms. Although we believe that two
water atoms at 2.4 A distance are too close, we only report water pairs that
are closer than this rather short distance.
 
INTRA and INTER indicate whether the clashes are between atoms in the same
asymmetric unit, or atoms in symmetry related asymmetric units, respectively.
The last text-item on each line represents the status of the atom pair. If
the final column contains the text 'HB', the bump criterion was relaxed
because there could be a hydrogen bond. Similarly relaxed criteria are used
for 1--3 and 1--4 interactions (listed as 'B2' and 'B3', respectively).
If the last column is 'BF', the sum of the B-factors of the atoms is higher
than 80, which makes the appearance of the bump somewhat less severe because
the atoms probably are not there anyway. BL, on the other hand, indicates
that the bumping atoms both have a low B-factor, and that makes the bumps
more worrisome.
 
Bumps between atoms for which the sum of their occupancies is lower than one
are not reported. If the MODEL number does not exist (as is the case in most
X-ray files), a minus sign is printed instead.
 
 2184 ASP  ( 303-) E  -    OD2 <-->  3066 ARG  ( 264-) G  -    NH1    0.79    1.91  INTRA BL
 4544 ARG  ( 412-) K  -    NH1 <-->  4572 VAL  ( 440-) K  -    O      0.76    1.94  INTRA BF
 1333 ARG  ( 412-) C  -    NH1 <-->  1361 VAL  ( 440-) C  -    O      0.75    1.95  INTRA BF
 2231 VAL  ( 350-) E  -    CG2 <-->  2235 HIS  ( 354-) E  -    ND1    0.69    2.41  INTRA BL
 5435 VAL  ( 350-) M  -    CG2 <-->  5439 HIS  ( 354-) M  -    ND1    0.68    2.42  INTRA
  325 PHE  ( 349-) A  -    O   <-->   330 ARG  ( 354-) A  -    NH1    0.68    2.02  INTRA BF
 3541 PHE  ( 349-) I  -    O   <-->  3546 ARG  ( 354-) I  -    NH1    0.66    2.04  INTRA BF
  733 ARG  ( 283-) B  -    NH2 <-->  2647 ASP  ( 306-) F  -    OD2    0.64    2.06  INTRA BL
 5388 ASP  ( 303-) M  -    OD2 <-->  6268 ARG  ( 264-) O  -    NH1    0.58    2.12  INTRA BL
 3950 ARG  ( 283-) J  -    NH2 <-->  5851 ASP  ( 306-) N  -    OD2    0.58    2.12  INTRA BL
  759 GLY  ( 309-) B  -    O   <-->   761 GLY  ( 311-) B  -    N      0.43    2.27  INTRA BL
 3976 GLY  ( 309-) J  -    O   <-->  3978 GLY  ( 311-) J  -    N      0.41    2.29  INTRA BL
  847 GLN  ( 397-) B  -    NE2 <-->   848 PHE  ( 398-) B  -    CE2    0.40    2.70  INTRA BF
  515 ASN  (  65-) B  -    OD1 <-->  2351 ILE  (  10-) F  -    CD1    0.39    2.41  INTRA BF
  123 GLN  ( 147-) A  -    NE2 <-->   406 VAL  ( 430-) A  -    CG1    0.38    2.72  INTRA BL
And so on for a total of   511 lines.
 
# 118 # Note: Some notes regarding these bumps
The bumps have been binned in 5 categories ranging from 'please look at'
till 'must fix'. Additionally, the integrated sum of all bumps, the squared
sum of all bumps, and these latter two values normalized by the number of
contacts are listed too for comparison purposes between, for example, small
and large proteins.
 
Total bump value: 54.558
Total bump value per residue: 0.080
Total number of bumps: 511
Total squared bump value: 12.433
Total number of bumps in the mildest bin: 474
Total number of bumps in the second bin: 27
Total number of bumps in the middle bin: 8
Total number of bumps in the fourth bin: 2
Total number of bumps in the worst bin: 0
 
# 119 # Note: Inside/outside distribution check
The following list contains per-residue Z-scores describing how well the
residue's observed accessibility fits the expected one. A positive Z-score
indicates "more exposure than usual", whereas a negative Z-score means
"more buried than usual". The absolute value of the Z-score must be used to
judge the quality. Today WHAT CHECK saw no reason to complain.
 
# 120 # Note: Inside/Outside residue distribution normal
The distribution of residue types over the inside and the outside of the
protein is normal.
 
inside/outside RMS Z-score : 1.017
 
# 121 # Note: Inside/Outside RMS Z-score plot
The Inside/Outside distribution normality RMS Z-score over a 15 residue
window is plotted as function of the residue number. High areas in the plot
(above 1.5) indicate unusual inside/outside patterns.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: A
 
# 122 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: B
 
# 123 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: C
 
# 124 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: D
 
# 125 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: E
 
# 126 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: F
 
# 127 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: G
 
# 128 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: H
 
# 129 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: I
 
# 130 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: J
 
# 131 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: K
 
# 132 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: L
 
# 133 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: M
 
# 134 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: N
 
# 135 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: O
 
# 136 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: P
 
# 137 # Warning: Abnormal packing environment for some residues
The residues listed in the table below have an unusual packing environment.
 
The packing environment of the residues is compared with the average packing
environment for all residues of the same type in good PDB files. A low
packing score can indicate one of several things: Poor packing, misthreading
of the sequence through the density, crystal contacts, contacts with a
co-factor, or the residue is part of the active site. It is not uncommon to
see a few of these, but in any case this requires further inspection of the
residue.
 
 1420 PHE  ( 499-) C  -  -7.28
 3946 ARG  ( 279-) J  -  -6.97
  729 ARG  ( 279-) B  -  -6.91
  815 ARG  ( 365-) B  -  -6.69
 4032 ARG  ( 365-) J  -  -6.62
 2439 GLN  (  98-) F  -  -6.49
 3838 ARG  ( 171-) J  -  -6.48
 2142 ARG  ( 261-) E  -  -6.47
 3617 TYR  ( 425-) I  -  -6.46
 5183 GLN  (  98-) M  -  -6.46
 5040 MET  ( 414-) L  -  -6.43
 1519 GLN  (  98-) D  -  -6.41
 4724 GLN  (  98-) L  -  -6.40
 6090 ARG  (  86-) O  -  -6.40
 1205 ARG  ( 279-) C  -  -6.38
And so on for a total of   111 lines.
 
# 138 # Warning: Abnormal packing environment for sequential residues
A stretch of at least three sequential residues with a questionable packing
environment was found. This could indicate that these residues are part
of a strange loop. It might also be an indication of misthreading in the
density. However, it can also indicate that one or more residues in this
stretch have other problems such as, for example, missing atoms, very
weird angles or bond lengths, etc.
 
The table below lists the first and last residue in each stretch found,
as well as the average residue score of the series.
 
  106 GLU  ( 130-) A  -      108 --- LYS   132- (A ) -       -5.11
  580 GLU  ( 130-) B  -      582 --- LYS   132- (B ) -       -4.86
  728 ARG  ( 278-) B  -      730 --- PRO   280- (B ) -       -5.45
  850 SER  ( 400-) B  -      852 --- LEU   402- (B ) -       -4.46
 1056 GLU  ( 130-) C  -     1058 --- LYS   132- (C ) -       -4.91
 1531 HIS  ( 110-) D  -     1533 --- GLU   112- (D ) -       -4.68
 1991 HIS  ( 110-) E  -     1993 --- GLU   112- (E ) -       -5.01
 2451 HIS  ( 110-) F  -     2453 --- GLU   112- (F ) -       -5.15
 3322 GLU  ( 130-) I  -     3324 --- LYS   132- (I ) -       -4.98
 3797 GLU  ( 130-) J  -     3799 --- LYS   132- (J ) -       -4.94
 3945 ARG  ( 278-) J  -     3947 --- PRO   280- (J ) -       -5.48
 4265 GLU  ( 130-) K  -     4267 --- LYS   132- (K ) -       -5.06
 4532 GLN  ( 397-) K  -     4535 --- SER   400- (K ) -       -4.64
 4736 HIS  ( 110-) L  -     4738 --- GLU   112- (L ) -       -4.96
 5195 HIS  ( 110-) M  -     5197 --- GLU   112- (M ) -       -5.18
 5655 HIS  ( 110-) N  -     5657 --- GLU   112- (N ) -       -5.14
 
# 139 # Note: Structural average packing environment OK
The structural average packing score is within normal ranges.
 
 
Average for range     1 - 6420 :  -0.231
 
# 140 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: A
 
# 141 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: B
 
# 142 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: C
 
# 143 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: D
 
# 144 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: E
 
# 145 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: F
 
# 146 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: G
 
# 147 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: H
 
# 148 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: I
 
# 149 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: J
 
# 150 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: K
 
# 151 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: L
 
# 152 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: M
 
# 153 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: N
 
# 154 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: O
 
# 155 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: P
 
# 156 # Warning: Low packing Z-score for some residues
The residues listed in the table below have an unusual packing
environment according to the 2nd generation packing check. The score
listed in the table is a packing normality Z-score: positive means
better than average, negative means worse than average. Only residues
scoring less than -2.50 are listed here. These are the unusual
residues in the structure, so it will be interesting to take a
special look at them.
 
 3364 GLN  ( 172-) I  -  -3.03
  606 MET  ( 156-) B  -  -2.96
 4498 VAL  ( 363-) K  -  -2.93
 3823 MET  ( 156-) J  -  -2.88
 4489 ARG  ( 354-) K  -  -2.73
 6113 ASN  ( 109-) O  -  -2.73
  330 ARG  ( 354-) A  -  -2.67
 1280 ARG  ( 354-) C  -  -2.65
 3546 ARG  ( 354-) I  -  -2.62
 4501 VAL  ( 366-) K  -  -2.59
 1292 VAL  ( 366-) C  -  -2.59
 1082 MET  ( 156-) C  -  -2.58
 2911 ASN  ( 109-) G  -  -2.56
 1753 TYR  ( 332-) D  -  -2.54
 4958 TYR  ( 332-) L  -  -2.52
 
# 157 # Note: No series of residues with abnormal new packing environment
There are no stretches of four or more residues each having a packing
Z-score worse than -1.75.
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
 
# 158 # Note: Second generation quality Z-score plot
The second generation quality Z-score smoothed over a 10 residue window
is plotted as function of the residue number. Low areas in the plot (below
-1.3) indicate unusual packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: A
 
# 159 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: B
 
# 160 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: C
 
# 161 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: D
 
# 162 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: E
 
# 163 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: F
 
# 164 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: G
 
# 165 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: H
 
# 166 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: I
 
# 167 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: J
 
# 168 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: K
 
# 169 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: L
 
# 170 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: M
 
# 171 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: N
 
# 172 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: O
 
# 173 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: P
 
# 174 # Warning: No crystallisation information
No, or very inadequate, crystallisation information was observed upon
reading the PDB file header records. This information should be available
in the form of a series of REMARK 280 lines. Without this information a
few things, such as checking ions in the structure, cannot be performed
optimally.
 
# 175 # Note: Water contacts OK
All water clusters make at least one contact with a non-water atom.
 
# 176 # Note: No waters need moving
All water molecules are sufficiently close to the asymmetric unit given in
the input file.
 
# 177 # Note: Water hydrogen bonds OK
All water molecules can form hydrogen bonds.
 
# 178 # Error: His, Asn, Gln side chain flips
Listed here are Histidine, Asparagine or Glutamine residues for
which the orientation determined from hydrogen bonding analysis are
different from the assignment given in the input. Either they could
form energetically more favourable hydrogen bonds if the terminal
group was rotated by 180 degrees, or there is no assignment in the
input file (atom type 'A') but an assignment could be made. Be aware,
though, that if the topology could not be determined for one or more
ligands, then this option will make errors.
 
  639 GLN  ( 189-) B  -
 1133 GLN  ( 207-) C  -
 2451 HIS  ( 110-) F  -
 2713 GLN  ( 372-) F  -
 2824 ASN  (  22-) G  -
 2931 ASN  ( 129-) G  -
 2962 ASN  ( 160-) G  -
 2974 ASN  ( 172-) G  -
 3065 ASN  ( 263-) G  -
 3102 GLN  (  18-) H  -
 3270 ASN  (  78-) I  -
 3378 GLN  ( 186-) I  -
 3856 GLN  ( 189-) J  -
 3933 HIS  ( 266-) J  -
 4085 GLN  ( 424-) J  -
And so on for a total of    34 lines.
 
# 179 # Note: Histidine type assignments
For all complete HIS residues in the structure a tentative assignment to
HIS-D (protonated on ND1), HIS-E (protonated on NE2), or HIS-H (protonated
on both ND1 and NE2, positively charged) is made based on the hydrogen bond
network. A second assignment is made based on which of the Engh and Huber
[REF] histidine geometries fits best to the structure.
 
In the table below all normal histidine residues are listed. The assignment
based on the geometry of the residue is listed first, together with the RMS
Z-score for the fit to the Engh and Huber parameters. For all residues where
the H-bond assignment is different, the assignment is listed in the last
columns, together with its RMS Z-score to the Engh and Huber parameters.
 
As always, the RMS Z-scores should be close to 1.0 if the residues were
restrained to the Engh and Huber parameters during refinement, and if
enough (high resolution) data is available.
 
Please note that because the differences between the geometries of the
different types are small it is possible that the geometric assignment given
here does not correspond to the type used in refinement. This is especially
true if the RMS Z-scores are much higher than 1.0.
 
If the two assignments differ, or the `geometry' RMS Z-score is high, it is
advisable to verify the hydrogen bond assignment, check the HIS type used
during the refinement and possibly adjust it.
 
   33 HIS  (  57-) A  -   HIS-E   0.73
   98 HIS  ( 122-) A  -   HIS-E   0.92
  231 HIS  ( 255-) A  -   HIS-E   1.39
  242 HIS  ( 266-) A  -   HIS-E   1.12
  270 HIS  ( 294-) A  -   HIS-E   1.11
  390 HIS  ( 414-) A  -   HIS-H   0.52 HIS-D   0.79
  402 HIS  ( 426-) A  -   HIS-E   0.69 HIS-D   0.95
  420 HIS  ( 444-) A  -   HIS-E   0.63
  507 HIS  (  57-) B  -   HIS-E   0.81
  572 HIS  ( 122-) B  -   HIS-E   1.02
  705 HIS  ( 255-) B  -   HIS-E   0.76 HIS-D   1.04
  716 HIS  ( 266-) B  -   HIS-E   1.39
  744 HIS  ( 294-) B  -   HIS-E   0.74
  864 HIS  ( 414-) B  -   HIS-E   0.58 HIS-D   1.34
  876 HIS  ( 426-) B  -   HIS-E   0.58 HIS-D   0.70
And so on for a total of    92 lines.
 
# 180 # Warning: Buried unsatisfied hydrogen bond donors
The buried hydrogen bond donors listed in the table below have a hydrogen
atom that is not involved in a hydrogen bond in the optimized hydrogen bond
network.
 
Hydrogen bond donors that are buried inside the protein normally use all of
their hydrogens to form hydrogen bonds within the protein. If there are any
non hydrogen bonded buried hydrogen bond donors in the structure they will
be listed here. In very good structures the number of listed atoms will tend
to zero.
 
Waters are not listed by this option.
 
    2 LYS  (  26-) A  -    N
    3 THR  (  27-) A  -    N
    4 SER  (  28-) A  -    N
   16 ARG  (  40-) A  -    NH1
   22 ASN  (  46-) A  -    N
   53 GLY  (  77-) A  -    N
   57 LEU  (  81-) A  -    N
   59 LYS  (  83-) A  -    N
   60 GLU  (  84-) A  -    N
   71 VAL  (  95-) A  -    N
   76 GLY  ( 100-) A  -    N
   79 LEU  ( 103-) A  -    N
   86 ALA  ( 110-) A  -    N
   87 LEU  ( 111-) A  -    N
  107 ARG  ( 131-) A  -    NE
And so on for a total of   684 lines.
 
# 181 # Warning: Buried unsatisfied hydrogen bond acceptors
The buried side-chain hydrogen bond acceptors listed in the table below are
not involved in a hydrogen bond in the optimized hydrogen bond network.
 
Side-chain hydrogen bond acceptors buried inside the protein normally form
hydrogen bonds within the protein. If there are any not hydrogen bonded in
the optimized hydrogen bond network they will be listed here.
 
Waters are not listed by this option.
 
   33 HIS  (  57-) A  -    ND1
   46 ASN  (  70-) A  -    OD1
  141 GLU  ( 165-) A  -    OE2
  270 HIS  ( 294-) A  -    ND1
  309 ASN  ( 333-) A  -    OD1
  409 GLN  ( 433-) A  -    OE1
  420 HIS  ( 444-) A  -    ND1
  422 ASP  ( 446-) A  -    OD1
  507 HIS  (  57-) B  -    ND1
  515 ASN  (  65-) B  -    OD1
  536 ASP  (  86-) B  -    OD2
  615 GLU  ( 165-) B  -    OE2
  704 GLU  ( 254-) B  -    OE1
  883 GLN  ( 433-) B  -    OE1
  907 GLU  ( 457-) B  -    OE1
And so on for a total of    87 lines.
 
# 182 # Note: Some notes regarding these donors and acceptors
The donors and acceptors have been counted, also as function of their
accessibility. The buried donors and acceptors have been binned in five
categories ranging from not forming any hydrogen bond till forming a poor
till perfect hydrogen bond. Obviously, the buried donors and acceptors
with no or just a poor hydrogen bond should be a topic of concern. As every
protein contains more acceptors than donors, unsatisfied donors are more in
need of attention than unsatisfied acceptors.
 
Total number of donors: 8960
- of which buried: 5201
Total number of acceptors: 9822
- of which buried: 4201
Total number of donor+acceptors: 919
  (e.g. the Ser Ogamma that can donate and accept)
- of which buried: 278
Buried donors: 5201
- without H-bond: 616
- essentially without H-bond: 3
- with only a very poor H-bond: 73
- with a poor H-bond: 106
- with a H-bond: 4403
Buried acceptors: 4201
- without H-bond: 685
- essentially without H-bond: 3
- with only a very poor H-bond: 121
- with a poor H-bond: 1034
- with a H-bond: 2358
 
# 183 # Note: Content of the PDB file as interpreted by WHAT CHECK
Content of the PDB file as interpreted by WHAT CHECK.
WHAT CHECK has read your PDB file, and stored it internally in what is called
'the soup'. The content of this soup is listed here. An extensive explanation
of all frequently used WHAT CHECK output formats can be found at
swift.cmbi.ru.nl. Look under output formats. A course on reading this
'Molecules' table is part of the WHAT CHECK website.
 
     1     1 (   25)   476 (  500) A Protein             /zata/tempdir/6q4...
     2   477 (   27)   950 (  500) B Protein             /zata/tempdir/6q4...
     3   951 (   25)  1323 (  397) C Protein             /zata/tempdir/6q4...
     4  1324 (  403)  1421 (  500) C Protein             /zata/tempdir/6q4...
     5  1422 (    1)  1881 (  460) D Protein             /zata/tempdir/6q4...
     6  1882 (    1)  2341 (  460) E Protein             /zata/tempdir/6q4...
     7  2342 (    1)  2803 (  462) F Protein             /zata/tempdir/6q4...
     8  2804 (    2)  3084 (  282) G Protein             /zata/tempdir/6q4...
     9  3085 (    1)  3218 (  134) H Protein             /zata/tempdir/6q4...
    10  3219 (   27)  3692 (  500) I Protein             /zata/tempdir/6q4...
    11  3693 (   26)  4064 (  397) J Protein             /zata/tempdir/6q4...
    12  4065 (  404)  4161 (  500) J Protein             /zata/tempdir/6q4...
    13  4162 (   27)  4535 (  400) K Protein             /zata/tempdir/6q4...
    14  4536 (  404)  4627 (  495) K Protein             /zata/tempdir/6q4...
    15  4628 (    2)  5086 (  460) L Protein             /zata/tempdir/6q4...
And so on for a total of    59 lines.
 
# 184 # Note: Summary report
This is an overall summary of the quality of the structure as compared with
current reliable structures. Numbers in brackets are the average and standard
deviation observed for a large number of files determined with a similar
resolution.
 
The second table mostly gives an impression of how well the model conforms
to common refinement restraint values. These numbers are less than 1.0 if the
spread in data is too little, and larger than 1.0 when the spread is too
large. The former does not need to be a problem, the latter always is bad.
 
 Structure Z-scores, positive is better than average:
  Resolution read from PDB file  :   3.600
  1st generation packing quality :   0.673 (          (  -1.8,  2.5))
  2nd generation packing quality :  -1.301 (          (  -2.5,  1.4))
  Ramachandran plot appearance   :  -3.917 (poor      (  -5.4,  2.6))
  chi-1/chi-2 rotamer normality  :  -5.797 (bad       (  -6.6,  2.5))
  Backbone conformation          :  -0.114 (          (  -1.5,  3.9))
  Inside/Outside distribution    :   1.017
 
 RMS Z-scores, should be close to 1.0:
  Bond lengths                   :   0.656 (tight)
  Bond angles                    :   0.940
  Omega angle restraints         :   1.298 (loose)
  Side chain planarity           :   1.411
  Improper dihedral distribution :   0.881
  B-factor distribution          :   1.108
 
# 185 # Note: Introduction to refinement recommendations
First, be aware that the recommendations for crystallographers listed below
are produced by a computer program that was written by a guy who got his
PhD in NMR...
 
We have tried to convert the messages written in this report into a small
set of things you can do with your refinement software to get a better
structure. The things you should do first are listed first. And in some
cases you should first fix that problem, then refine a bit further, and
then run WHAT CHECK again before looking at other problems. If, for example,
WHAT CHECK has found a problem with the SCALE and CRYST cards, then you must
first fix that problem, refine the structure a bit further, and run WHAT
CHECK again because errors in the SCALE and or CRYST card can lead to many
problems elsewhere in the validation process.
 
It is also important to keep in mind that WHAT CHECK is software and that it
occasionally totally misunderstands what is the cause of a problem. But, if
WHAT CHECK lists a problem there normally is a problem albeit that it not
always is the actual problem that gets listed.
 
# 186 # Note: Matthews coefficient problem
WHAT CHECK detected a Matthews coefficient problem. Most times this is an
administrative problem caused by typing the wrong cell multiplicity number
on the CRYST card (or not typing it at all). Occasionally it is caused by
typing the wrong space group on the CRYST card. You better fix this problem,
but normally this problem does not cause WHAT CHECK to give any erroneous
error messages further down in the report.
 
# 187 # Note: Cell parameter anomaly
WHAT CHECK has compared the observed bond lengths with the Engh and Huber
parameters, and has done this as function of the direction of the bond
relative to the cell axes. From this analysis it was concluded that the
cell dimensions are probably not entirely perfect. The problem is not very
big, so you do not need to fix this before you start dealing with the other
suggestions, but you better fix this.
 
If this problem is caused by refining with another set of target values
than the Engh and Huber values, then WHAT CHECK cannot help you because
systematic target value deviations can also cause this message to pop up.
 
# 188 # Error: Bumps in your structure
Upon analysing the bumps in your structure, WHAT CHECK got very, very
worried. Sometimes this means that you have forgotten to lower the
occupancy of overlapping ligands, residues, or water molecules. But,
whatever is the origin of this problem, you have to analyse it and
fix it.
 
# 189 # Note: Bond length variabilty Z-score high
With a resolution of 3 Angstrom or worse, you dont have enough data to
warrant the bond length variability that we observed. So, tighten the
screws on the bond length target values.
 
# 190 # Note: Bond angle variabilty Z-score high
With a resolution of 3 Angstrom or worse, you dont have enough data to
warrant the bond angle variability that we observed. So, tighten the screws
on the bond angle target values.
 
# 191 # Note: Omega angles insufficiently restraint
Omega angles tend to fall around 178 degrees with a standard deviation of 5.5
degrees. With a resolution of 3 Angstrom or worse, you dont have enough data
to warrant the omega angle variability that we observed. The variability is
larger than 7.0 degrees. So, tighten the screws on the omega angle target
values a lot. What you are doing is called overrefinement.
 
# 192 # Note: His, Asn, Gln side chain flips.
His, Asn, and Gln have an asymmetry in their side chain that is hard to
detect unless you have data at much better than 1.0 Angstrom resolution.
WHAT CHECK thinks that your structure contains His, Asn, or Gln residues that
will make better hydrogen bonds when flipped around their chi-2, chi-2, or
chi-3 side chain torsion angle, respectively. You better
check these Asn, His, and Gln residues, and if you use a refinement program
that includes molecular dynamics, then you must (after the
flips were made) refine a bit further before running WHAT CHECK again.
 
# 193 # Warning: Troublesome residues
The residues listed in the table below need to be inspected
 
This table is a very rough attempt to sort the residues according to how
badly they need your attention. The idea is that when you sit in  in front
of the graphics screen and study the residues with the electron density
present that you improve the structure most by dealing with the top residues
in this list first.
 
 3066 ARG  ( 264-) G  -     20.86
  476 ASN  ( 500-) A  -     20.51
 5643 GLN  (  98-) N  -     20.21
 1248 GLN  ( 322-) C  -     19.73
 2142 ARG  ( 261-) E  -     19.64
 3692 ASN  ( 500-) I  -     19.05
    1 ILE  (  25-) A  -     17.99
 2184 ASP  ( 303-) E  -     17.95
 1956 ILE  (  75-) E  -     17.71
  815 ARG  ( 365-) B  -     17.61
 4032 ARG  ( 365-) J  -     17.28
  729 ARG  ( 279-) B  -     16.91
 2439 GLN  (  98-) F  -     16.65
 1044 LYS  ( 118-) C  -     16.51
 2231 VAL  ( 350-) E  -     16.47
And so on for a total of   861 lines.
==============
 
 
WHAT IF
    G.Vriend,
      WHAT IF: a molecular modelling and drug design program,
    J. Mol. Graph. 8, 52--56 (1990).
 
WHAT_CHECK (verification routines from WHAT IF)
    R.W.W.Hooft, G.Vriend, C.Sander and E.E.Abola,
      Errors in protein structures
    Nature 381, 272 (1996).
    (see also http://swift.cmbi.ru.nl/gv/whatcheck for a course and extra
    information)
 
PDB facilities
    Touw WG, Baakman C, Black J, te Beek TA, Krieger E, Joosten RP, Vriend G.
      A series of PDB-related databanks for everyday needs.
    Nucleic Acids Research D364-368 Database issue (2015).
 
Bond lengths and angles, protein residues
    R.Engh and R.Huber,
      Accurate bond and angle parameters for X-ray protein structure
      refinement,
    Acta Crystallogr. A47, 392--400 (1991) and
    R.Engh and R.Huber,
    International Tables for Crystallography (2001)
 
 
Bond lengths and angles, DNA/RNA
    G.Parkinson, J.Voitechovsky, L.Clowney, A.T.Bruenger and H.Berman,
      New parameters for the refinement of nucleic acid-containing structures
    Acta Crystallogr. D52, 57--64 (1996).
 
DSSP
    W.Kabsch and C.Sander,
      Dictionary of protein secondary structure: pattern
      recognition of hydrogen bond and geometrical features
    Biopolymers 22, 2577--2637 (1983).
 
Hydrogen bond networks
    R.W.W.Hooft, C.Sander and G.Vriend,
      Positioning hydrogen atoms by optimizing hydrogen bond networks in
      protein structures
    PROTEINS, 26, 363--376 (1996).
 
Matthews' Coefficient
    B.W.Matthews
      Solvent content of Protein Crystals
    J. Mol. Biol. 33, 491--497 (1968).
 
Peptide flips
    Touw WG, Joosten RP, Vriend G.
      Detection of trans-cis flips and peptide-plane flips in protein
      structures.
    Acta Crystallogr D Biological Crystallograhy 71, 1604-1614 (2015).
 
Protein side chain planarity
    R.W.W. Hooft, C. Sander and G. Vriend,
      Verification of protein structures: side-chain planarity
    J. Appl. Cryst. 29, 714--716 (1996).
 
Puckering parameters
    D.Cremer and J.A.Pople,
      A general definition of ring puckering coordinates
    J. Am. Chem. Soc. 97, 1354--1358 (1975).
 
Quality Control
    G.Vriend and C.Sander,
      Quality control of protein models: directional atomic
      contact analysis,
    J. Appl. Cryst. 26, 47--60 (1993).
 
Ramachandran plot
    G.N.Ramachandran, C.Ramakrishnan and V.Sasisekharan,
      Stereochemistry of Polypeptide Chain Conformations
    J. Mol. Biol. 7, 95--99 (1963).
    R.W.W. Hooft, C.Sander and G.Vriend,
      Objectively judging the quality of a protein structure from a
      Ramachandran plot
    CABIOS (1997), 13, 425--430.
 
Symmetry Checks
    R.W.W.Hooft, C.Sander and G.Vriend,
      Reconstruction of symmetry related molecules from protein
      data bank (PDB) files
    J. Appl. Cryst. 27, 1006--1009 (1994).
 
Tau angle
    W.G.Touw and G.Vriend
      On the complexity of Engh and Huber refinement restraints: the angle
      tau as example.
    Acta Crystallogr D 66, 1341--1350 (2010).
 
Ion Checks
    I.D.Brown and K.K.Wu,
      Empirical Parameters for Calculating Cation-Oxygen Bond Valences
    Acta Cryst. B32, 1957--1959 (1975).
 
    M.Nayal and E.Di Cera,
      Valence Screening of Water in Protein Crystals Reveals Potential Na+
      Binding Sites
    J.Mol.Biol. 256 228--234 (1996).
 
    P.Mueller, S.Koepke and G.M.Sheldrick,
      Is the bond-valence method able to identify metal atoms in protein
      structures?
    Acta Cryst. D 59 32--37 (2003).
 
Checking checks
    K.Wilson, C.Sander, R.W.W.Hooft, G.Vriend, et al.
      Who checks the checkers
    J.Mol.Biol. (1998) 276,417-436.
==============
 
 
WHAT IF
    G.Vriend,
      WHAT IF: a molecular modelling and drug design program,
    J. Mol. Graph. 8, 52--56 (1990).
 
WHAT_CHECK (verification routines from WHAT IF)
    R.W.W.Hooft, G.Vriend, C.Sander and E.E.Abola,
      Errors in protein structures
    Nature 381, 272 (1996).
    (see also http://swift.cmbi.ru.nl/gv/whatcheck for a course and extra
    information)
 
PDB facilities
    Touw WG, Baakman C, Black J, te Beek TA, Krieger E, Joosten RP, Vriend G.
      A series of PDB-related databanks for everyday needs.
    Nucleic Acids Research D364-368 Database issue (2015).
 
Bond lengths and angles, protein residues
    R.Engh and R.Huber,
      Accurate bond and angle parameters for X-ray protein structure
      refinement,
    Acta Crystallogr. A47, 392--400 (1991) and
    R.Engh and R.Huber,
    International Tables for Crystallography (2001)
 
 
Bond lengths and angles, DNA/RNA
    G.Parkinson, J.Voitechovsky, L.Clowney, A.T.Bruenger and H.Berman,
      New parameters for the refinement of nucleic acid-containing structures
    Acta Crystallogr. D52, 57--64 (1996).
 
DSSP
    W.Kabsch and C.Sander,
      Dictionary of protein secondary structure: pattern
      recognition of hydrogen bond and geometrical features
    Biopolymers 22, 2577--2637 (1983).
 
Hydrogen bond networks
    R.W.W.Hooft, C.Sander and G.Vriend,
      Positioning hydrogen atoms by optimizing hydrogen bond networks in
      protein structures
    PROTEINS, 26, 363--376 (1996).
 
Matthews' Coefficient
    B.W.Matthews
      Solvent content of Protein Crystals
    J. Mol. Biol. 33, 491--497 (1968).
 
Peptide flips
    Touw WG, Joosten RP, Vriend G.
      Detection of trans-cis flips and peptide-plane flips in protein
      structures.
    Acta Crystallogr D Biological Crystallograhy 71, 1604-1614 (2015).
 
Protein side chain planarity
    R.W.W. Hooft, C. Sander and G. Vriend,
      Verification of protein structures: side-chain planarity
    J. Appl. Cryst. 29, 714--716 (1996).
 
Puckering parameters
    D.Cremer and J.A.Pople,
      A general definition of ring puckering coordinates
    J. Am. Chem. Soc. 97, 1354--1358 (1975).
 
Quality Control
    G.Vriend and C.Sander,
      Quality control of protein models: directional atomic
      contact analysis,
    J. Appl. Cryst. 26, 47--60 (1993).
 
Ramachandran plot
    G.N.Ramachandran, C.Ramakrishnan and V.Sasisekharan,
      Stereochemistry of Polypeptide Chain Conformations
    J. Mol. Biol. 7, 95--99 (1963).
    R.W.W. Hooft, C.Sander and G.Vriend,
      Objectively judging the quality of a protein structure from a
      Ramachandran plot
    CABIOS (1997), 13, 425--430.
 
Symmetry Checks
    R.W.W.Hooft, C.Sander and G.Vriend,
      Reconstruction of symmetry related molecules from protein
      data bank (PDB) files
    J. Appl. Cryst. 27, 1006--1009 (1994).
 
Tau angle
    W.G.Touw and G.Vriend
      On the complexity of Engh and Huber refinement restraints: the angle
      tau as example.
    Acta Crystallogr D 66, 1341--1350 (2010).
 
Ion Checks
    I.D.Brown and K.K.Wu,
      Empirical Parameters for Calculating Cation-Oxygen Bond Valences
    Acta Cryst. B32, 1957--1959 (1975).
 
    M.Nayal and E.Di Cera,
      Valence Screening of Water in Protein Crystals Reveals Potential Na+
      Binding Sites
    J.Mol.Biol. 256 228--234 (1996).
 
    P.Mueller, S.Koepke and G.M.Sheldrick,
      Is the bond-valence method able to identify metal atoms in protein
      structures?
    Acta Cryst. D 59 32--37 (2003).
 
Checking checks
    K.Wilson, C.Sander, R.W.W.Hooft, G.Vriend, et al.
      Who checks the checkers
    J.Mol.Biol. (1998) 276,417-436.
