************************************************************************
********** REPORT OF PROTEIN ANALYSIS  by the WHAT IF program **********
************************************************************************

Date : 2024-12-06
This report was created by WHAT IF version WHATCHECK15.0

This document is a WHAT_CHECK 14.0 report for a PDB-file. Each reported
fact has an assigned severity, one of:

error  : Items marked as errors are considered severe problems requiring
         immediate attention.
warning: Either less severe problems or uncommon structural features. These
         still need special attention.
note   : Statistical values, plots, or other verbose results of tests and
         analyses that have been performed.

If alternate conformations are present, only the first is evaluated. Hydrogen
atoms are only included if explicitly requested, and even then they are not
used in all checks. The software functions less well for non-canonical amino
acids and exotic ligands than for the 20 canonical residues and canonical
nucleic acids.

Some remarks regarding the output:

Residues/atoms in tables are normally given in a few parts:

A number. This is the internal sequence number of the residue used by WHAT IF.
    The first residues in the file get number 1, 2, etc.
The residue type. Normally this is a three letter amino acid type.
The sequence number, between brackets. This is the residue number as it was
    given in the input file. It can be followed by the insertion code.
The chain identifier. A single character. If no chain identifier was given in
    the input file, this will be a minus sign or a blank.
A model number. If no model number exists, like in most X-ray files, this will
    be a blank or occasionally a minus sign.
In case an atom is part of the output, the atom will be listed using the PDB
    nomenclature for type and identifier.

To indicate the normality of a score, the score may be expressed as a Z-value
   or Z-score. This is just the number of standard deviations that the score
   deviates from the expected value. A property of Z-values is that the
   root-mean-square of a group of Z-values (the RMS Z-value) is expected to be
   1.0. Z-values above 4.0 and below -4.0 are very uncommon. If a Z-score is
   used in WHAT IF, the accompanying text will explain how the expected value
   and standard deviation were obtained.
The names of nucleic acids are DGUA, DTHY, OCYT, OADE, etc. The first character
   is a D or O for DNA or RNA respectively. This circumvents ambiguities in the
   many old PDB files in which DNA and RNA were both called A, C, G, and T.



=========================================
==== Compound code /zata/tempdir/3d0g/wctemf/3d0g_final.pdb         ====
=========================================
 
# 1 # Note: Introduction
WHAT CHECK needs to read a PDB file before it can check it. It does a
series of checks upon reading the file. The results of these checks are
reported in this section (section 2.1). The rest of the report will be more
systematic in that section 2.2 reports on administrative problems. Section
2.3 gives descriptive output that is not directly validating things but
more telling you how WHAT CHECK interpreted the input file. Section 2.4
looks at B-factors, occupancies, and the presence/absence of (spurious)
atoms. Section 2.5 deals with nomenclature problems. Section 2.6 deals with
geometric problems like bond lengths and bond angles. Section 2.7 deals with
torsion angle issues. Section 2.8 looks at atomic clashes. Section 2.9 deals
with packing, accessibility, etc, issues. Section 2.10 deals with hydrogen
bonds, ion packing, and other things that can be summarized under the common
name charge-charge interactions. Section 2.11 gives a summary of whole report
and tells you (if applicable) which symmetry matrices were used. Section 2.12
tells the crystallographer which are the things most in need of manual
correction. And the last section, section 2.13, lists all residues sorted
by their need for visual inspection in light of the electron density.
WARNING. Date error on HEADER card:
HEADER                                                        3D0G
ATOM  *****  C2  NDG A 616      28.467 -14.540 100.335  1.00 71.92       C2  C
ATOM  *****  C3  NDG A 616      28.897 -13.389 101.241  1.00 74.37       C3  C
ATOM  *****  C4  NDG A 616      29.242 -13.885 102.640  1.00 76.94       C4  C
ATOM  *****  C5  NDG A 616      30.266 -15.016 102.567  1.00 77.21       C5  C
ATOM  *****  C6  NDG A 616      30.542 -15.651 103.912  1.00 79.32       C6  C
ATOM  *****  C7  NDG A 616      27.956 -14.901  97.963  1.00 68.99       C7  C
ATOM  *****  C8  NDG A 616      26.544 -15.387  97.829  1.00 61.99       C8  C
ATOM  *****  O5  NDG A 616      29.775 -16.066 101.710  1.00 76.30       O5  O
ATOM  *****  O3  NDG A 616      27.850 -12.431 101.287  1.00 72.78       O3  O
ATOM  *****  O4  NDG A 616      29.794 -12.810 103.396  1.00 81.07       O4  O
ATOM  *****  O6  NDG A 616      31.941 -15.747 104.166  1.00 81.54       O6  O
ATOM  *****  O7  NDG A 616      28.838 -15.243  97.182  1.00 66.00       O7  O
ATOM  *****  N2  NDG A 616      28.199 -14.079  98.987  1.00 70.48       N2  N
ATOM  *****  O1  NDG A 616      30.687 -15.196  99.776  1.00 68.78       O1  O
ATOM  *****  C2  NDG B 616      52.455  24.219  34.942  1.00 82.73       C2  C
ATOM  *****  C3  NDG B 616      52.281  24.908  36.293  1.00 76.46       C3  C
ATOM  *****  C4  NDG B 616      51.502  26.203  36.110  1.00 78.85       C4  C
ATOM  *****  C5  NDG B 616      50.149  25.878  35.485  1.00 86.16       C5  C
ATOM  *****  C6  NDG B 616      49.315  27.108  35.209  1.00 88.75       C6  C
ATOM  *****  C7  NDG B 616      54.159  22.646  34.146  1.00 77.44       C7  C
ATOM  *****  C8  NDG B 616      55.594  22.824  34.543  1.00 69.02       C8  C
ATOM  *****  O5  NDG B 616      50.350  25.214  34.220  1.00 90.33       O5  O
ATOM  *****  O3  NDG B 616      53.549  25.150  36.886  1.00 72.81       O3  O
ATOM  *****  O4  NDG B 616      51.303  26.845  37.366  1.00 76.28       O4  O
ATOM  *****  O6  NDG B 616      48.334  26.853  34.204  1.00 90.27       O6  O
ATOM  *****  O7  NDG B 616      53.843  22.196  33.049  1.00 79.07       O7  O
ATOM  *****  N2  NDG B 616      53.243  23.007  35.050  1.00 82.51       N2  N
ATOM  *****  O1  NDG B 616      50.364  23.063  35.045  1.00 87.61       O1  O
ATOM  *****  C2  NDG B 617      51.152  41.149  66.783  1.00 91.75       C2  C
ATOM  *****  C3  NDG B 617      51.652  41.432  68.199  1.00 92.19       C3  C
ATOM  *****  C4  NDG B 617      51.519  42.916  68.512  1.00 92.00       C4  C
ATOM  *****  C5  NDG B 617      50.051  43.319  68.388  1.00 95.61       C5  C
ATOM  *****  C6  NDG B 617      49.813  44.794  68.651  1.00 91.61       C6  C
ATOM  *****  C7  NDG B 617      51.897  39.264  65.371  1.00 74.36       C7  C
ATOM  *****  C8  NDG B 617      53.393  39.383  65.368  1.00 73.02       C8  C
ATOM  *****  O5  NDG B 617      49.586  43.053  67.048  1.00 87.82       O5  O
ATOM  *****  O3  NDG B 617      52.999  41.004  68.345  1.00 99.86       O3  O
ATOM  *****  O4  NDG B 617      51.990  43.173  69.834  1.00 81.04       O4  O
ATOM  *****  O6  NDG B 617      48.989  45.398  67.647  1.00 72.36       O6  O
ATOM  *****  O7  NDG B 617      51.285  38.749  64.438  1.00 50.48       O7  O
ATOM  *****  N2  NDG B 617      51.267  39.740  66.453  1.00 81.03       N2  N
ATOM  *****  O1  NDG B 617      48.833  40.910  67.301  1.00 82.96       O1  O
ATOM  *****  C2  NDG B 618      46.345  30.286  76.994  1.00 55.35       C2  C
ATOM  *****  C3  NDG B 618      46.315  31.429  78.005  1.00 59.17       C3  C
ATOM  *****  C4  NDG B 618      47.671  31.581  78.683  1.00 61.32       C4  C
ATOM  *****  C5  NDG B 618      48.680  31.946  77.598  1.00 68.43       C5  C
ATOM  *****  C6  NDG B 618      50.057  32.301  78.127  1.00 81.60       C6  C
ATOM  *****  C7  NDG B 618      44.212  29.415  76.124  1.00 47.74       C7  C
ATOM  *****  C8  NDG B 618      43.168  29.550  75.055  1.00 39.83       C8  C
ATOM  *****  O5  NDG B 618      48.846  30.805  76.731  1.00 56.79       O5  O
ATOM  *****  O3  NDG B 618      45.280  31.154  78.940  1.00 64.35       O3  O
ATOM  *****  O4  NDG B 618      47.641  32.578  79.704  1.00 46.78       O4  O
ATOM  *****  O6  NDG B 618      50.942  31.175  78.129  1.00 82.13       O6  O
ATOM  *****  O7  NDG B 618      44.177  28.509  76.950  1.00 43.73       O7  O
ATOM  *****  N2  NDG B 618      45.176  30.345  76.138  1.00 50.08       N2  N
ATOM  *****  O1  NDG B 618      47.403  30.946  75.007  1.00 55.49       O1  O
ATOM  *****  C2  NDG F  91      54.326  29.456  37.417  1.00 89.64       C2  C
ATOM  *****  C3  NDG F  91      55.611  30.143  37.878  1.00 88.91       C3  C
ATOM  *****  C4  NDG F  91      56.090  29.597  39.218  1.00 84.21       C4  C
ATOM  *****  C5  NDG F  91      56.252  28.085  39.119  1.00 81.51       C5  C
ATOM  *****  C6  NDG F  91      56.730  27.460  40.411  1.00 80.62       C6  C
ATOM  *****  C7  NDG F  91      52.809  30.219  35.634  1.00 91.31       C7  C
ATOM  *****  C8  NDG F  91      52.770  31.456  34.786  1.00 69.19       C8  C
ATOM  *****  O5  NDG F  91      54.969  27.504  38.811  1.00 82.00       O5  O
ATOM  *****  O3  NDG F  91      55.378  31.542  37.962  1.00 92.51       O3  O
ATOM  *****  O4  NDG F  91      57.345  30.179  39.561  1.00 76.86       O4  O
ATOM  *****  O6  NDG F  91      56.524  26.049  40.422  1.00 74.86       O6  O
ATOM  *****  O7  NDG F  91      51.793  29.595  35.925  1.00 86.53       O7  O
ATOM  *****  N2  NDG F  91      54.019  29.830  36.050  1.00 96.25       N2  N
ATOM  *****  O1  NDG F  91      55.195  27.419  36.539  1.00 85.77       O1  O
ATOM  *****  O   HOH B 906       2.809  34.018  54.512  1.00 48.92       906 O
ATOM  *****  O   HOH B 909       7.390  16.316  75.496  1.00 55.86       909 O
ATOM  *****  O   HOH B 910       9.463  14.344  70.635  1.00 51.40       910 O
ATOM  *****  O   HOH B 911      45.823  46.194  54.582  1.00 65.31       911 O
ATOM  *****  O   HOH B 912      44.037  40.434  68.593  1.00 58.90       912 O
ATOM  *****  O   HOH B 913      17.185  24.371  85.429  1.00 54.28       913 O
ATOM  *****  O   HOH B 914      14.537  25.350  82.389  1.00 48.34       914 O
ATOM  *****  O   HOH B 915      23.568  31.805  86.919  1.00 66.47       915 O
ATOM  *****  O   HOH B 916      24.090  35.635  79.908  1.00 56.46       916 O
ATOM  *****  O   HOH B 917      26.661  35.541  81.624  1.00 61.97       917 O
ATOM  *****  O   HOH B 919      21.184  31.615  67.038  1.00 63.79       919 O
ATOM  *****  O   HOH B 920      13.484  36.161  64.516  1.00 54.58       920 O
ATOM  *****  O   HOH B 921      11.200  48.028  64.661  1.00 48.93       921 O
ATOM  *****  O   HOH B 922      18.178  41.498  40.841  1.00 65.38       922 O
ATOM  *****  O   HOH B 923      35.179  33.299  40.822  1.00 69.33       923 O
ATOM  *****  O   HOH F  11      57.325  42.416  47.003  1.00 49.90        11 O
ATOM  *****  O   HOH F  12      83.641  61.123  40.716  1.00 59.99        12 O
ATOM  *****  O   HOH F  24      56.327  35.985  33.756  1.00 78.68        24 O
ATOM  *****  O   HOH F  25      55.501  35.143  31.313  1.00 76.25        25 O
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
 
# 2 # Note: Header records from PDB file
Header records from PDB file.
 
HEADER                                                        3D0G
 
# 3 # Error: Missing unit cell information
No SCALE matrix is given in the PDB file.
 
# 4 # Note: Proposal for corrected SCALE matrix
A corrected SCALE matrix has been derived.
 
Proposed scale matrix
  0.012499  0.000000  0.001362
  0.000000  0.008350  0.000000
  0.000000  0.000000  0.009246
 
# 5 # Note: Non crystallographic symmetry RMS plot
The plot shows the RMS differences between two similar chains on a residue-
by-residue basis. Individual "spikes" can be indicative of interesting or
wrong residues. If all residues show a high RMS value, the structure could
be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: E and F
 
 All-atom RMS fit for the two chains : 0.783
 CA-only RMS fit for the two chains : 0.339
 
# 6 # Note: Non crystallographic symmetry backbone difference plot
The plot shows the differences in backbone torsion angles between two
similar chains on a residue-by-residue basis. Individual "spikes" can be
indicative of interesting or wrong residues. If all residues show high
differences, the structure could be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: E and F
 
# 7 # Warning: Problem detected upon counting molecules and matrices
The parameter Z as given on the CRYST card represents the molecular
multiplicity in the crystallographic cell. Normally, Z equals the number of
matrices of the space group multiplied by the number of NCS relations. The
value of Z is multiplied by the integrated molecular weight of the molecules
in the file to determine the Matthews coefficient. This relation is being
validated in this option. Be aware that the validation can get confused if
both multiple copies of the molecule are present in the ATOM records and
MTRIX records are present in the header of the PDB file.
 
 Space group as read from CRYST card: P 1 21 1
 Number of matrices in space group: 2
 Highest polymer chain multiplicity in structure: 2
 Highest polymer chain multiplicity according to SEQRES: 2
 No explicit MTRIX NCS matrices found in the input file
 Value of Z as found on the CRYST1 card: 0
 Z, symmetry, and molecular multiplicity disagree
 Could it be that Z must be: 4
 
# 8 # Error: Matthews Coefficient (Vm) very high
 
The Matthews coefficient [REF] is defined as the density of the protein
structure in cubic Angstroms per Dalton. Normal values are between 1.5
(tightly packed, little room for solvent) and 4.0 (loosely packed, much
space for solvent). Some very loosely packed structures can get values a bit
higher than that.
 
Numbers this high are almost always caused by giving the wrong value for Z
on the CRYST1 card (or not giving this number at all).
 
 Molecular weight of all polymer chains: 177634.953
 Volume of the Unit Cell V= 1036385.4
 Space group multiplicity: 2
 No NCS symmetry matrices (MTRIX records) found in PDB file
 Matthews coefficient for observed atoms and Z is high: Vm= 11.669
 No Matthews coefficient given in REMARK 280
 Or should we use the previously suggested Z = 4
 which would result in Vm= 2.917
 And remember, a matrix counting problem has been reported earlier already
 
# 9 # Note: All atoms are sufficiently far away from symmetry axes
None of the atoms in the structure is closer than 0.77 Angstrom to a proper
symmetry axis.
 
# 10 # Note: Chain identifiers OK
WHAT CHECK has not detected any serious chain identifier problems. But be
aware that WHAT CHECK doesn't care about the chain identifiers of waters.
 
# 11 # Warning: Ligands for which a topology was generated automatically
The topology for the ligands in the table below were determined
automatically. WHAT CHECK uses a local copy of the CCP4 monomer library to
generate topology information for ligands. Be aware that automatic topology
generation is a complicated task. So, if you get messages that you fail to
understand or that you believe are wrong, and one of these ligands is
involved, then check the ligand topology entry first. This topology is either
present in the monomer library, or as a libcheck-generated file in the local
directory.
 
 1546 NDG  ( 616-) A  -
 1549 NDG  ( 616-) B  -
 1550 NDG  ( 617-) B  -
 1551 NDG  ( 618-) B  -
 1555 NDG  (  91-) F  -
 
# 12 # Note: Covalently bound ligands
No problems were detected that seem related to covalently bound ligands.
 
# 13 # Note: No strange inter-chain connections detected
No covalent bonds have been detected between molecules with non-identical
chain identifiers.
 
# 14 # Note: No duplicate atom names in ligands
All atom names in ligands (if any) seem adequately unique.
 
# 15 # Note: In all cases the primary alternate atom was used
WHAT CHECK saw no need to make any alternate atom corrections (which means
they either are all correct, or there are none).
 
# 16 # Note: No residues detected inside ligands
Either this structure does not contain ligands with amino acid groups inside
it, or their naming is proper (enough).
 
# 17 # Note: No attached groups interfere with hydrogen bond calculations
It seems there are no sugars, lipids, etc., bound (or very close) to atoms
that otherwise could form hydrogen bonds.
 
# 18 # Note: No probable side chain atoms with zero occupancy detected.
Either there are no side chain atoms with zero occupancy, or the side chain
atoms with zero occupancy were not present in the input PDB file (in which
case they are listed as missing atoms), or their positions are sufficiently
improbable to warrant a zero occupancy.
 
# 19 # Note: No probable backbone atoms with zero occupancy detected.
Either there are no backbone atoms with zero occupancy, or the backbone
atoms with zero occupancy were left out of the input PDB file (in
which case they are listed as missing atoms), or their positions are
sufficiently improbable to warrant a zero occupancy.
 
# 20 # Note: All residues have a complete backbone.
No residues have missing backbone atoms.
 
# 21 # Note: No C-alpha only residues
There are no residues that consist of only an alpha carbon atom.
 
# 22 # Note: Content of the PDB file as interpreted by WHAT CHECK
Content of the PDB file as interpreted by WHAT CHECK.
WHAT CHECK has read your PDB file, and stored it internally in what is called
'the soup'. The content of this soup is listed here. An extensive explanation
of all frequently used WHAT CHECK output formats can be found at
swift.cmbi.ru.nl. Look under output formats. A course on reading this
'Molecules' table is part of the WHAT CHECK website.
 
     1     1 (   19)   597 (  615) A Protein             /zata/tempdir/3d0...
     2   598 (   19)  1194 (  615) B Protein             /zata/tempdir/3d0...
     3  1195 (  324)  1367 (  502) E Protein             /zata/tempdir/3d0...
     4  1368 (  324)  1540 (  502) F Protein             /zata/tempdir/3d0...
     5  1541 (   91)  1541 (   91) E Sugar<-             /zata/tempdir/3d0...
     6  1542 (  615)  1542 (  615) A D O2 <-   597       /zata/tempdir/3d0...
     7  1543 (  615)  1543 (  615) B D O2 <-  1194       /zata/tempdir/3d0...
     8  1544 (  502)  1544 (  502) E E O2 <-  1367       /zata/tempdir/3d0...
     9  1545 (  502)  1545 (  502) F E O2 <-  1540       /zata/tempdir/3d0...
    10  1546 (  616)  1546 (  616) A NDG                 /zata/tempdir/3d0...
    11  1547 (  901)  1547 (  901) A  ZN                 /zata/tempdir/3d0...
    12  1548 (  902)  1548 (  902) A  CL                 /zata/tempdir/3d0...
    13  1549 (  616)  1549 (  616) B NDG                 /zata/tempdir/3d0...
    14  1550 (  617)  1550 (  617) B NDG                 /zata/tempdir/3d0...
    15  1551 (  618)  1551 (  618) B NDG                 /zata/tempdir/3d0...
    16  1552 (  901)  1552 (  901) B  ZN                 /zata/tempdir/3d0...
    17  1553 (  902)  1553 (  902) B  CL                 /zata/tempdir/3d0...
    18  1554 (   91)  1554 (   91) E NAG  <-             /zata/tempdir/3d0...
    19  1555 (   91)  1555 (   91) F NDG                 /zata/tempdir/3d0...
    20  1556 ( HOH )  1556 ( HOH ) B water   (    1)     /zata/tempdir/3d0...
    21  1557 ( HOH )  1557 ( HOH ) F water   (    1)     /zata/tempdir/3d0...
MODELs skipped upon reading PDB file: 0
X-ray structure. No MODELs found
The total number of amino acids found is 1540
of which 42 have poor or (essentially) missing atoms
No nucleic acids observed in input file
Number of (recognized) sugars: 1
Number of water molecules: 2
Residue numbers increase monotonously OK
 
# 23 # Note: Chain identifiers seem OK
All ions seem to have a logical chain identifier, or there are no ions
present in the input file.
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
 
# 24 # Note: Ramachandran plot
In this Ramachandran plot x-signs represent glycines, squares represent
prolines, and plus-signs represent the other residues. If too many
plus-signs fall outside the contoured areas then the molecule is poorly
refined (or worse). Proline can only occur in the narrow region around
phi=-60 that also falls within the other contour islands.
 
In a colour picture, the residues that are part of a helix are shown in blue,
strand residues in red. Preferred regions for helical residues are drawn in
blue, for strand residues in red, and for all other residues in green. A full
explanation of the Ramachandran plot together with a series of examples can
be found at the WHAT CHECK website [REF].
 
In the TeX file, a plot has been inserted here
 
Chain identifier: A
 
# 25 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: B
 
# 26 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: E
 
# 27 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: F
 
# 28 # Note: Secondary structure
This is the secondary structure according to DSSP. Only helix (H), overwound
or 3/10-helix (3), strand (S), turn (T) and coil (blank) are shown [REF].
All DSSP related information can be found at swift.cmbi.ru.nl/gv/dssp/
This is not really a structure validation option, but a very scattered
secondary structure (i.e. many strands of only a few residues length, many
Ts inside helices, etc) tends to indicate a poor structure. A full
explanation of the DSSP secondary structure determination program together
with a series of examples can be found at the WHAT CHECK website [REF].
 
Secondary structure assignment
                     10        20        30        40        50        60
                      |         |         |         |         |         |
    1 -   60 STTEELAKTFLETFNYEAQELSYQSSVASWNYNTNITEENVQNMNNAGDKWSAFLKEQST
(  19)-(  78)
                     70        80        90       100       110       120
                      |         |         |         |         |         |
   61 -  120 LAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNP
(  79)-( 138)
                    130       140       150       160       170       180
                      |         |         |         |         |         |
  121 -  180 QECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYED
( 139)-( 198)
                    190       200       210       220       230       240
                      |         |         |         |         |         |
  181 -  240 YGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISP
( 199)-( 258)
                    250       260       270       280       290       300
                      |         |         |         |         |         |
  241 -  300 IGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSV
( 259)-( 318)
                    310       320       330       340       350       360
                      |         |         |         |         |         |
  301 -  360 GLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGH
( 319)-( 378)
                    370       380       390       400       410       420
                      |         |         |         |         |         |
  361 -  420 IQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINF
( 379)-( 438)
                    430       440       450       460       470       480
                      |         |         |         |         |         |
  421 -  480 LLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYC
( 439)-( 498)
                    490       500       510       520       530       540
                      |         |         |         |         |         |
  481 -  540 DPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNML
( 499)-( 558)
                    550       560       570       580       590
                      |         |         |         |         |
  541 -  597 RLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYAD
( 559)-( 615)
             600       610       620       630       640       650
               |         |         |         |         |         |
  598 -  657 STTEELAKTFLETFNYEAQELSYQSSVASWNYNTNITEENVQNMNNAGDKWSAFLKEQST
(  19)-(  78)
             660       670       680       690       700       710
               |         |         |         |         |         |
  658 -  717 LAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNP
(  79)-( 138)
             720       730       740       750       760       770
               |         |         |         |         |         |
  718 -  777 QECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYED
( 139)-( 198)
             780       790       800       810       820       830
               |         |         |         |         |         |
  778 -  837 YGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISP
( 199)-( 258)
             840       850       860       870       880       890
               |         |         |         |         |         |
  838 -  897 IGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSV
( 259)-( 318)
             900       910       920       930       940       950
               |         |         |         |         |         |
  898 -  957 GLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGH
( 319)-( 378)
             960       970       980       990      1000      1010
               |         |         |         |         |         |
  958 - 1017 IQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINF
( 379)-( 438)
            1020      1030      1040      1050      1060      1070
               |         |         |         |         |         |
 1018 - 1077 LLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYC
( 439)-( 498)
            1080      1090      1100      1110      1120      1130
               |         |         |         |         |         |
 1078 - 1137 DPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNML
( 499)-( 558)
            1140      1150      1160      1170      1180      1190
               |         |         |         |         |         |
 1138 - 1194 RLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYAD
( 559)-( 615)
               1200      1210      1220      1230      1240      1250
                  |         |         |         |         |         |
 1195 - 1254 PFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNVYADSFVV
( 324)-( 389)
               1260      1270      1280      1290      1300      1310
                  |         |         |         |         |         |
 1255 - 1314 KGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLR
( 390)-( 449)
               1320      1330      1340      1350      1360
                  |         |         |         |         |
 1315 - 1367 PFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFE
( 450)-( 502)
            1370      1380      1390      1400      1410      1420
               |         |         |         |         |         |
 1368 - 1427 PFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNVYADSFVV
( 324)-( 389)
            1430      1440      1450      1460      1470      1480
               |         |         |         |         |         |
 1428 - 1487 KGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLR
( 390)-( 449)
            1490      1500      1510      1520      1530      1540
               |         |         |         |         |         |
 1488 - 1540 PFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFE
( 450)-( 502)
 
 
 
 
# 29 # Note: No rounded coordinates detected
No significant rounding of atom coordinates has been detected.
 
# 30 # Note: No artificial side chains detected
No artificial side-chain positions characterized by chi-1=0.0 or chi-1=180.0
have been detected.
 
# 31 # Warning: Unexpected atoms encountered
While reading the PDB file, at least one atom was encountered that
was not expected in the residue. This might be caused by a naming
convention problem. It can also mean that a residue was found protonated
that normally is not (e.g. aspartic acid). The unexpected atoms have been
discarded; in case protons were deleted that actually might be needed, they
will later be put back by the hydrogen bond validation software.
This normally is not a warning you should worry too much about.
 
# 32 # Note: No missing atoms detected in residues
All expected atoms are present in residues. This validation option has not
looked at 'things' that can or should be attached to the elementary building
blocks (amino acids, nucleotides). Even the C-terminal oxygens are treated
separately.
 
# 33 # Warning: B-factors outside the range 0.0 - 100.0
In principle, B-factors can have a very wide range of values, but in
practice, B-factors should not be zero while B-factors above 100.0
are a good indicator that the location of that atom is meaningless. Be
aware that the cutoff at 100.0 is arbitrary. 'High' indicates that atoms
with a B-factor > 100.0 were observed; 'Zero' indicates that atoms with
a B-factor of zero were observed.
 
   32 TYR  (  50-) A  -   High
   85 ASN  ( 103-) A  -   High
   86 GLY  ( 104-) A  -   High
   87 SER  ( 105-) A  -   High
   88 SER  ( 106-) A  -   High
  384 GLU  ( 402-) A  -   High
  404 GLY  ( 422-) A  -   High
  405 LEU  ( 423-) A  -   High
  406 LEU  ( 424-) A  -   High
  407 SER  ( 425-) A  -   High
  408 PRO  ( 426-) A  -   High
  409 ASP  ( 427-) A  -   High
  410 PHE  ( 428-) A  -   High
  411 GLN  ( 429-) A  -   High
  423 LYS  ( 441-) A  -   High
And so on for a total of    42 lines.
 
# 34 # Note: C-terminus capping
The residues listed in the table below are either C-terminal or pseudo
C-terminal (i.e. last residue before a missing residue).
In X-ray the coordinates must be located in density. Mobility or disorder
sometimes cause this density to be so poor that the positions of the atoms
cannot be determined. Crystallographers tend to leave out the atoms in such
cases. In many cases the N- or C-terminal residues are too disordered to see.
In case of the N-terminus, you can often see from the residue numbers if
there are missing residues; at the C-terminus this is impossible. Therefore,
often the position of the backbone nitrogen of the first residue missing
at the C-terminal end is calculated and added to indicate that there
are missing residues. As a single N causes validation trouble, we remove
these single-N-residues before doing the validation. If this happened,
the label -N is added to the pseudo C-terminus. Other labels can be +X
in case something weird is bound to the backbone C, or +OXT if a spurious
OXT atom is found. -OXT indicates that an expected OXT is missing. 'Swap'
means that the O' and O'' (O and OXT in PDB files) have been swapped in
terms of nomenclature. 'Bad' means that something bad happened that WHAT IF
does not understand. In such cases you might get three residue numbers in
square brackets; one of those might be what WHAT IF had expected to find,
but then it also might not). In case of chain breaks the number of missing
residues is listen in round brackets. OK means what it suggests...
 
Be aware that we cannot easily see the difference between these errors and
errors in the chain and residue numbering schemes. So do not blindly trust
the table below. If you get weird errors at, or near, the left-over
incomplete C-terminal residue, please check by hand if a missing Oxt or
a removed single N is the cause. Also, many peptidic ligands get the same
chain identifier as the larger protein they are bound to. In such cases there
are more than one C-termini and OXTs with the same ID. WHAT IF gives some
random warnings about these cases. So, don't take everything at face value,
but think for yourself.
 
  597 ASP  ( 615-) A  -        +OXT [ 597 ; 597 ; 615]
 1194 ASP  ( 615-) B  -        +OXT [1194 ; 597 ; 615]
 1246 ASN  ( 375-) E  -        OK (6)
 1367 GLU  ( 502-) E  -        +OXT [1367 ; 597 ; 502]
 1419 ASN  ( 375-) F  -        OK (6)
 1540 GLU  ( 502-) F  -        +OXT [1540 ; 597 ; 502]
 1541 NAG  (  91-) E  -        +X
 
# 35 # Note: Weights administratively correct
All atomic occupancy factors ('weights') fall in the 0.0--1.0 range, which
makes them administratively correct.
 
# 36 # Note: Normal distribution of occupancy values
 
The distribution of the occupancy values in this file seems 'normal'.
 
Be aware that this evaluation is merely the result of comparing this file
with about 500 well-refined high-resolution files in the PDB. If this file
has much higher or much lower resolution than the PDB files used
in WHAT CHECK's training set, non-normal values might very well be perfectly
fine, or normal values might actually be not so normal. So, this check is
actually more an indicator and certainly not a check in which I have great
confidence.
 
# 37 # Note: All occupancies seem to add up to 0.0 - 1.0.
In principle, the occupancy of all alternates of one atom should add up till
0.0 - 1.0. 0.0 is used for the missing atom (i.e. an atom not seen in the
electron density). Obviously, there is nothing terribly wrong when a few
occupancies add up to a bit more than 1.0, because the mathematics of
refinement allow for that. However, if it happens often, it seems worth
evaluating this in light of the refinement protocol used.
 
# 38 # Warning: What type of B-factor?
WHAT CHECK does not yet know well how to cope with B-factors in case TLS has
been used. It simply assumes that the B-factor listed on the ATOM and HETATM
cards are the total B-factors. When TLS refinement is used that assumption
sometimes is not correct. The header of the PDB file states that TLS groups
were used. So, if WHAT CHECK complains about your  B-factors, while you think
that they are OK, then check for TLS related B-factor problems first.
 
Number of TLS groups mentione in PDB file header: 14
 
Temperature not mentioned in PDB file. This most likely means
that the temperature record is absent.
Room temperature assumed
 
# 39 # Note: Number of buried atoms with low B-factor is OK
For protein structures determined at room temperature, no more than about 1
percent of the B factors of buried atoms is below 5.0. In liquid
nitrogen this percentage is allowed to be higher, of course.
 
Percentage of buried atoms with B less than 5 :   0.00
 
# 40 # Note: B-factor distribution normal
The distribution of B-factors within residues is within expected ranges.
A value over 1.5 here would mean that the B-factors show signs of
over-refinement.
 
RMS Z-score :  0.948 over   11184 bonds
Average difference in B over a bond :    3.11
RMS difference in B over a bond :    4.23
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
 
# 41 # Note: B-factor plot
The average atomic B-factor per residue is plotted as function of the residue
number.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: A
 
# 42 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: B
 
# 43 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: E
 
# 44 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: F
 
# 45 # Note: Introduction to the nomenclature section.
Nomenclature problems seem, at first, rather unimportant. After all who
cares if we call the delta atoms in leucine delta2 and delta1 rather than
the other way around. Chemically speaking that is correct. But structures
have not been solved and deposited just for chemists to look at them. Most
times a structure is used, it is by software in a bioinformatics lab. And
if they compare structures in which the one used C delta1 and delta2 and the
other uses C delta2 and delta1, then that comparison will fail. Also, we
recalculate all structures every so many years to make sure that everybody
always can get access to the best coordinates that can be obtained from
the (your?) experimental data. These recalculations will be troublesome if
there are nomenclature problems.
 
Several nomenclature problems actually are worse than that. At the
WHAT CHECK website [REF] you can get an overview of the importance of all
nomenclature problems that we list.
 
# 46 # Note: Valine nomenclature OK
No errors were detected in valine nomenclature.
 
# 47 # Note: Threonine nomenclature OK
No errors were detected in threonine nomenclature.
 
# 48 # Note: Isoleucine nomenclature OK
No errors were detected in isoleucine nomenclature.
 
# 49 # Note: Leucine nomenclature OK
No errors were detected in leucine nomenclature.
 
# 50 # Note: Arginine nomenclature OK
No errors were detected in arginine nomenclature.
 
# 51 # Note: Tyrosine torsion conventions OK
No errors were detected in tyrosine torsion angle conventions.
 
# 52 # Note: Phenylalanine torsion conventions OK
No errors were detected in phenylalanine torsion angle conventions.
 
# 53 # Note: Aspartic acid torsion conventions OK
No errors were detected in aspartic acid torsion angle conventions.
 
# 54 # Note: Glutamic acid torsion conventions OK
No errors were detected in glutamic acid torsion angle conventions.
 
# 55 # Note: Phosphate group names OK in DNA/RNA
No errors were detected in nucleic acid phosphate group naming conventions
(or this structure contains no nucleic acids).
 
# 56 # Note: Heavy atom naming OK
No errors were detected in the atom names for non-hydrogen atoms. Please
be aware that the PDB wants us to deliberately make some nomenclature errors;
especially in non-canonical amino acids.
 
# 57 # Note: No decreasing residue numbers
All residue numbers are strictly increasing within each chain.
 
# 58 # Warning: Unusual bond lengths
The bond lengths listed in the table below were found to deviate more than 4
sigma from standard bond lengths (both standard values and sigmas for amino
acid residues have been taken from Engh and Huber [REF], for DNA they were
taken from Parkinson et al [REF]). In the table below for each unusual bond
the bond length and the number of standard deviations it differs from the
normal value is given.
 
Atom names starting with "-" belong to the previous residue in the chain. If
the second atom name is "-SG*", the disulphide bridge has a deviating length.
 
  215 ILE  ( 233-) A  -    CG1  CD1   1.26   -6.4
  252 MET  ( 270-) A  -    SD   CE    1.54   -4.2
 1262 ILE  ( 397-) E  -    CG1  CD1   1.34   -4.5
 
# 59 # Note: Normal bond length variability
Bond lengths were found to deviate normally from the standard bond lengths
(values for Protein residues were taken from Engh and Huber [REF], for
DNA/RNA from Parkinson et al [REF]).
 
 RMS Z-score for bond lengths: 0.391
 RMS-deviation in bond distances: 0.010
 
# 60 # Note: No bond length directionality
Comparison of bond distances with Engh and Huber [REF] standard values for
protein residues and Parkinson et al [REF] values for DNA/RNA does not show
significant systematic deviations.
 
# 61 # Warning: Unusual bond angles
The bond angles listed in the table below were found to deviate more than 4
sigma from standard bond angles (both standard values and sigma for protein
residues have been taken from Engh and Huber [REF], for DNA/RNA from
Parkinson et al [REF]). In the table below for each strange angle the bond
angle and the number of standard deviations it differs from the standard
values is given. Please note that disulphide bridges are neglected. Atoms
starting with "-" belong to the previous residue in the sequence.
 
  251 ASP  ( 269-) A  -    CA   CB   CG  117.61    5.0
  317 ASP  ( 335-) A  -    CA   CB   CG  116.82    4.2
  332 ASP  ( 350-) A  -    CA   CB   CG  116.92    4.3
  384 GLU  ( 402-) A  -    CB   CG   CD  119.58    4.1
  393 SER  ( 411-) A  -    C    CA   CB  120.34    5.4
  848 ASP  ( 269-) B  -    CA   CB   CG  117.58    5.0
  914 ASP  ( 335-) B  -    CA   CB   CG  117.01    4.4
  929 ASP  ( 350-) B  -    CA   CB   CG  117.22    4.6
 1267 THR  ( 402-) E  -    N    CA   CB  117.82    4.3
 1398 VAL  ( 354-) F  -    C    CA   CB  120.94    5.7
 1404 PHE  ( 360-) F  -    CA   CB   CG  118.28    4.5
 1445 ASP  ( 407-) F  -    CA   CB   CG  117.32    4.7
 
# 62 # Note: Normal bond angle variability
Bond angles were found to deviate normally from the mean standard bond angles
(normal values for protein residues were taken from Engh and Huber [REF], for
DNA/RNA from Parkinson et al [REF]). The RMS Z-score given below is expected
to be near 1.0 for a normally restrained data set, and this is indeed
observed for very high resolution X-ray structures.
 
 RMS Z-score for bond angles: 0.643
 RMS-deviation in bond angles: 1.189
 
# 63 # Note: Residue hand check OK
No atoms are observed that have the wrong handedness. Be aware, though, that
WHAT CHECK might have corrected the handedness of some atoms already. The
handedness has not been corrected for any case where the problem is worse
than just an administrative discomfort.
 
# 64 # Warning: Chirality deviations detected
The atoms listed in the table below have an improper dihedral value
that is deviating from expected values. As the improper dihedral values
are all getting very close to ideal values in recent X-ray structures,
and as we actually do not know how big the spread around these values
should be, this check only warns for 6 sigma deviations.
 
Improper dihedrals are a measure of the chirality/planarity of the structure
at a specific atom. Values around -35 or +35 are expected for chiral atoms,
and values around 0 for planar atoms. Planar side chains are left out of the
calculations, these are better handled by the planarity checks.
 
Three numbers are given for each atom in the table. The first is the Z-score
for the improper dihedral. The second number is the measured improper
dihedral. The third number is the expected value for this atom type. A final
column contains an extra warning if the chirality for an atom is opposite
to the expected value.
 
  393 SER  ( 411-) A  -    CA   -28.0   -14.67    34.26 Wrong hand
 1267 THR  ( 402-) E  -    CA   -38.2   -24.91    33.85 Wrong hand
 1398 VAL  ( 354-) F  -    CA   -35.5   -16.41    33.31 Wrong hand
 1510 LEU  ( 472-) F  -    CA   -44.6   -30.12    34.17 Wrong hand
The average deviation= 0.585
 
# 65 # Note: Improper dihedral angle distribution OK
The RMS Z-score for all improper dihedrals in the structure is within normal
ranges.
 
 Improper dihedral RMS Z-score : 0.497
 
# 66 # Note: Tau angles OK
All of the tau angles (N-C-alpha-C) of amino acids fall within expected
RMS deviations.
 
# 67 # Note: Normal tau angle deviations
The RMS Z-score for the tau angles (N-C-alpha-C) in the structure falls
within the normal range that we guess to be 0.5 - 1.5. Be aware, we
determined the tau normal distributions from 500 high-resolution X-ray
structures, rather than from CSD data, so we cannot be 100 percent certain
about these numbers.
 
 Tau angle RMS Z-score : 0.717
 
# 68 # Note: Side chain planarity OK
All of the side chains of residues that have an intact planar group are
planar within expected RMS deviations.
 
# 69 # Note: Atoms connected to aromatic rings OK
All of the atoms that are connected to planar aromatic rings in side chains
of amino-acid residues are in the plane within expected RMS deviations.
Since there is no DNA and no protein with hydrogens, no uncalibrated
planarity check was performed.
 
# 70 # Error: Ramachandran Z-score very low
The score expressing how well the backbone conformations of all residues
correspond to the known allowed areas in the Ramachandran plot is very low.
 
 Ramachandran Z-score : -4.364
 
# 71 # Note: Ramachandran check
The list contains per-residue Z-scores describing how well each residue
fits into the allowed areas of the Ramachandran plot will not be printed
because WHAT CHECK found no reason to cry.
 
# 72 # Warning: Torsion angle evaluation shows unusual residues
The residues listed in the table below contain bad or abnormal
torsion angles.
 
These scores give an impression of how `normal' the torsion angles in
protein residues are. All torsion angles except omega are used for
calculating a `normality' score. Average values and standard deviations were
obtained from the residues in the WHAT CHECK database. These are used to
calculate Z-scores. A residue with a Z-score of below -2.0 is poor, and a
score of less than -3.0 is worrying. For such residues more than one torsion
angle is in a highly unlikely position.
 
  717 PRO  ( 138-) B  -   -2.9
   34 THR  (  52-) A  -   -2.8
 1400 TYR  ( 356-) F  -   -2.8
 1408 PHE  ( 364-) F  -   -2.7
 1413 VAL  ( 369-) F  -   -2.7
    3 THR  (  21-) A  -   -2.7
 1235 PHE  ( 364-) E  -   -2.6
  633 ILE  (  54-) B  -   -2.6
  664 LEU  (  85-) B  -   -2.6
  599 THR  (  20-) B  -   -2.6
  316 THR  ( 334-) A  -   -2.6
 1506 THR  ( 468-) F  -   -2.6
  393 SER  ( 411-) A  -   -2.5
 1508 PRO  ( 470-) F  -   -2.5
  321 VAL  ( 339-) A  -   -2.5
And so on for a total of    54 lines.
 
# 73 # Warning: Backbone evaluation reveals unusual conformations
The residues listed in the table below have abnormal backbone torsion
angles.
 
Residues with `forbidden' phi-psi combinations are listed, as well as
residues with unusual omega angles (deviating by more than 3 sigma from the
normal value). Please note that it is normal if about 5 percent of the
residues is listed here as having unusual phi-psi combinations.
 
    3 THR  (  21-) A  - Poor phi/psi
   32 TYR  (  50-) A  - omega poor
   34 THR  (  52-) A  - Poor phi/psi
   38 GLU  (  56-) A  - Poor phi/psi, omega poor
   39 GLU  (  57-) A  - Poor phi/psi, omega poor
   65 TYR  (  83-) A  - Omega to (next) Pro poor
   68 GLN  (  86-) A  - Poor phi/psi, omega poor
   83 GLN  ( 101-) A  - omega poor
   86 GLY  ( 104-) A  - Poor phi/psi
  116 ASN  ( 134-) A  - Omega to (next) Pro poor
  119 ASN  ( 137-) A  - Omega to (next) Pro poor
  127 GLU  ( 145-) A  - Omega to (next) Pro poor
  128 PRO  ( 146-) A  - omega poor
  135 ALA  ( 153-) A  - omega poor
  136 ASN  ( 154-) A  - Poor phi/psi
And so on for a total of   217 lines.
 
# 74 # Error: Chi-1/chi-2 rotamer problems
List of residues with a poor chi-1/chi-2 combination. Be aware that for this
validation option the individual scores are far less important than the
overall score that is given below the table.
 
    6 LEU  (  24-) A  -    -1.32
   55 LEU  (  73-) A  -    -1.32
   67 LEU  (  85-) A  -    -1.32
   73 LEU  (  91-) A  -    -1.31
   82 LEU  ( 100-) A  -    -1.32
   90 LEU  ( 108-) A  -    -1.32
  124 LEU  ( 142-) A  -    -1.32
  161 LEU  ( 179-) A  -    -1.31
  263 LEU  ( 281-) A  -    -1.32
  315 LEU  ( 333-) A  -    -1.32
  352 LEU  ( 370-) A  -    -1.32
  400 LEU  ( 418-) A  -    -1.32
  405 LEU  ( 423-) A  -    -1.32
  422 LEU  ( 440-) A  -    -1.32
  432 LEU  ( 450-) A  -    -1.32
And so on for a total of   709 lines.
 
# 75 # Warning: chi-1/chi-2 angle correlation Z-score low
The score expressing how well the chi-1/chi-2 angles of all residues
correspond to the populated areas in the database is
a bit low.
 
 chi-1/chi-2 correlation Z-score : -3.997
 
# 76 # Warning: Unusual rotamers
The residues listed in the table below have a rotamer that is not seen very
often in the database of solved protein structures. This option determines
for every residue the position specific chi-1 rotamer distribution.
Thereafter it verified whether the actual residue in the molecule has the
most preferred rotamer or not. If the actual rotamer is the preferred one,
the score is 1.0. If the actual rotamer is unique, the score is 0.0. If
there are two preferred rotamers, with a population distribution of 3:2 and
your rotamer sits in the lesser populated rotamer, the score will be 0.667.
No value will be given if insufficient hits are found in the database.
 
It is not necessarily an error if a few residues have rotamer values below
0.3, but careful inspection of all residues with these low values could be
worth it.
 
   95 SER  ( 113-) A  -   0.35
  106 SER  ( 124-) A  -   0.35
  692 SER  ( 113-) B  -   0.35
  990 SER  ( 411-) B  -   0.35
 1259 VAL  ( 394-) E  -   0.36
   26 SER  (  44-) A  -   0.36
  623 SER  (  44-) B  -   0.36
  649 SER  (  70-) B  -   0.36
  703 SER  ( 124-) B  -   0.36
  487 HIS  ( 505-) A  -   0.37
   52 SER  (  70-) A  -   0.38
  548 TRP  ( 566-) A  -   0.38
  391 SER  ( 409-) A  -   0.39
 
# 77 # Warning: Unusual backbone conformations
For the residues listed in the table below, the backbone formed by itself and
two neighbouring residues on either side is in a conformation that is not
seen very often in the database of solved protein structures. The number
given in the table is the number of similar backbone conformations in the
database with the same amino acid in the centre.
 
For this check, backbone conformations are compared with database structures
using C-alpha superpositions with some restraints on the backbone oxygen
positions.
 
A residue mentioned in the table can be part of a strange loop, or there
might be something wrong with it or its directly surrounding residues. There
are a few of these in every protein, but in any case it is worth looking at,
especially if a regular DSSP secondary structure (H or S for helix or strand,
respectively) is indicated!
 
   33 ASN  (  51-) A  -       0
   34 THR  (  52-) A  -       0
   38 GLU  (  56-) A  -       0
   39 GLU  (  57-) A  -       0
   68 GLN  (  86-) A  -       0
  127 GLU  ( 145-) A  -       0
  195 ASP  ( 213-) A  -       0
  283 ALA  ( 301-) A  -       0
  284 TRP  ( 302-) A  -       0
  320 ASN  ( 338-) A  -       0
  321 VAL  ( 339-) A  -       0
  322 GLN  ( 340-) A  -       0
  326 CYS  ( 344-) A  -       0
  393 SER  ( 411-) A  -       0
  394 ALA  ( 412-) A  -       0
And so on for a total of    75 lines.
 
# 78 # Note: Backbone conformation Z-score OK
The backbone conformation analysis gives a score that is normal for well
refined protein structures.
 
 Backbone conformation Z-score : -0.589
 
# 79 # Note: Omega angle restraint OK
The omega angles for trans-peptide bonds in a structure is expected to give a
gaussian distribution with the average around +178 degrees, and a standard
deviation around 5.5. In the current structure the standard deviation agrees
with this expectation.
 
Omega average and std. deviation= 179.220 6.455
 
# 80 # Warning: Unusual PRO puckering amplitudes
The proline residues listed in the table below have a puckering amplitude
that is outside of normal ranges. Puckering parameters were calculated by
the method of Cremer and Pople [REF]. Normal PRO rings have a puckering
amplitude Q between 0.20 and 0.45 Angstrom. If Q is lower than 0.20 Angstrom
for a PRO residue, this could indicate disorder between the two different
normal ring forms (with C-gamma below and above the ring, respectively). If
Q is higher than 0.45 Angstrom something could have gone wrong during the
refinement. Be aware that this is a warning with a low confidence level. See:
Who checks the checkers? Four validation tools applied to eight atomic
resolution structures [REF]
 
  915 PRO  ( 336-) B  -   0.17 LOW
 1264 PRO  ( 399-) E  -   0.11 LOW
 
# 81 # Warning: Unusual PRO puckering phases
The proline residues listed in the table below have a puckering phase that is
not expected to occur in protein structures. Puckering parameters were
calculated by the method of Cremer and Pople [REF]. Normal PRO rings
approximately show a so-called envelope conformation with the C-gamma atom
above the plane of the ring (phi=+72 degrees), or a half-chair conformation
with C-gamma below and C-beta above the plane of the ring (phi=-90 degrees).
If phi deviates strongly from these values, this is indicative of a very
strange conformation for a PRO residue, and definitely requires a manual
check of the data. Be aware that this is a warning with a low confidence
level. See: Who checks the checkers? Four validation tools applied to eight
atomic resolution structures [REF].
 
  240 PRO  ( 258-) A  -   45.1 half-chair C-delta/C-gamma (54 degrees)
  271 PRO  ( 289-) A  -  -50.1 half-chair C-beta/C-alpha (-54 degrees)
  717 PRO  ( 138-) B  -  -42.8 envelop C-alpha (-36 degrees)
  725 PRO  ( 146-) B  -  -64.9 envelop C-beta (-72 degrees)
  837 PRO  ( 258-) B  -   46.2 half-chair C-delta/C-gamma (54 degrees)
 1335 PRO  ( 470-) E  -   28.0 envelop C-delta (36 degrees)
 1508 PRO  ( 470-) F  -   27.9 envelop C-delta (36 degrees)
 
# 82 # Warning: Backbone oxygen evaluation
The residues listed in the table below have an unusual backbone oxygen
position.
 
For each of the residues in the structure, a search was performed to find
5-residue stretches in the WHAT CHECK database with superposable C-alpha
coordinates, and some restraints on the neighbouring backbone oxygens.
 
In the following table the RMS distance between the backbone oxygen positions
of these matching structures in the database and the position of the backbone
oxygen atom in the current residue is given. If this number is larger than
1.5 a significant number of structures in the database show an alternative
position for the backbone oxygen. If the number is larger than 2.0 most
matching backbone fragments in the database have the peptide plane flipped.
A manual check needs to be performed to assess whether the experimental data
can support that alternative as well. The number in the last column is the
number of database hits (maximum 80) used in the calculation. It is "normal"
that some glycine residues show up in this list, but they are still worth
checking!
 
 1329 GLY  ( 464-) E  -  3.00   75
 1502 GLY  ( 464-) F  -  2.92   80
 1441 GLY  ( 403-) F  -  2.60   45
  790 GLY  ( 211-) B  -  2.34   10
  657 THR  (  78-) B  -  1.91   42
 1520 GLY  ( 482-) F  -  1.57   22
 
# 83 # Warning: Possible peptide flips
For the residues listed in the table below, the backbone formed by the
residue mentioned and the one N-terminal of it show systematic deviations
from normality that are consistent with a peptide flip. This can either
be a 180 degree flip of the entire peptide plane or a trans to cis flip.
(Cis to trans flips cannot be detected yet). The type can be TT+, TC-,
or TC+:
TT+ indicates a 180 degree flip of the entire peptide plane.
TC- indicates a trans to cis conversion that requires a flip of the N atom.
TC+ indicates a trans to cis conversion that requires a flip of the O atom.
Note that the method will only work correctly for PDB files with full
isotropic B-factors.
 
   34 THR  (  52-) A  - TT+   Highly likely
 1176 ASP  ( 597-) B  - TT+   Highly likely
 1201 ASN  ( 330-) E  - TT+   Highly likely
   35 ASN  (  53-) A  - TT+   Likely
   68 GLN  (  86-) A  - TT+   Likely
  195 ASP  ( 213-) A  - TT+   Likely
  234 TYR  ( 252-) A  - TT+   Likely
  267 PHE  ( 285-) A  - TT+   Likely
  284 TRP  ( 302-) A  - TT+   Likely
  321 VAL  ( 339-) A  - TT+   Likely
  322 GLN  ( 340-) A  - TT+   Likely
  326 CYS  ( 344-) A  - TT+   Likely
  395 ALA  ( 413-) A  - TT+   Likely
  528 ASN  ( 546-) A  - TT+   Likely
  715 ASP  ( 136-) B  - TT+   Likely
  716 ASN  ( 137-) B  - TT+   Likely
  792 ASP  ( 213-) B  - TT+   Likely
  918 VAL  ( 339-) B  - TT+   Likely
  919 GLN  ( 340-) B  - TT+   Likely
 1223 TYR  ( 352-) E  - TT+   Likely
 1338 ASN  ( 473-) E  - TT+   Likely
 1396 TYR  ( 352-) F  - TT+   Likely
 1401 ASN  ( 357-) F  - TT+   Likely
 1442 VAL  ( 404-) F  - TT+   Likely
 1453 ASP  ( 415-) F  - TT+   Likely
 1501 ASP  ( 463-) F  - TT+   Likely
 
# 84 # Error: Abnormally short interatomic distances
The pairs of atoms listed in the table below have an unusually short
interactomic distance; each bump is listed in only one direction.
 
The contact distances of all atom pairs have been checked. Two atoms are
said to `bump' if they are closer than the sum of their Van der Waals radii
minus 0.40 Angstrom. For hydrogen bonded pairs a tolerance of 0.55 Angstrom
is used. The first number in the table tells you how much shorter that
specific contact is than the acceptable limit. The second distance is the
distance between the centres of the two atoms. Although we believe that two
water atoms at 2.4 A distance are too close, we only report water pairs that
are closer than this rather short distance.
 
INTRA and INTER indicate whether the clashes are between atoms in the same
asymmetric unit, or atoms in symmetry related asymmetric units, respectively.
The last text-item on each line represents the status of the atom pair. If
the final column contains the text 'HB', the bump criterion was relaxed
because there could be a hydrogen bond. Similarly relaxed criteria are used
for 1--3 and 1--4 interactions (listed as 'B2' and 'B3', respectively).
If the last column is 'BF', the sum of the B-factors of the atoms is higher
than 80, which makes the appearance of the bump somewhat less severe because
the atoms probably are not there anyway. BL, on the other hand, indicates
that the bumping atoms both have a low B-factor, and that makes the bumps
more worrisome.
 
Bumps between atoms for which the sum of their occupancies is lower than one
are not reported. If the MODEL number does not exist (as is the case in most
X-ray files), a minus sign is printed instead.
 
  953 HIS  ( 374-) B  -    CE1 <-->  1552  ZN  ( 901-) B  -   ZN      0.56    2.64  INTRA BL
   87 SER  ( 105-) A  -    O   <-->    90 LEU  ( 108-) A  -    CD2    0.47    2.33  INTRA BF
  209 GLU  ( 227-) A  -    OE2 <-->   440 LYS  ( 458-) A  -    NZ     0.39    2.31  INTRA BF
  664 LEU  (  85-) B  -    O   <-->   666 GLU  (  87-) B  -    N      0.32    2.38  INTRA BF
 1434 GLN  ( 396-) F  -    OE1 <-->  1441 GLY  ( 403-) F  -    O      0.30    1.95  INTRA BF
  664 LEU  (  85-) B  -    O   <-->   667 ILE  (  88-) B  -    CG2    0.27    2.53  INTRA BF
  751 VAL  ( 172-) B  -    CG2 <-->   752 GLY  ( 173-) B  -    N      0.27    2.73  INTRA BF
  270 LYS  ( 288-) A  -    NZ  <-->   413 ASP  ( 431-) A  -    OD2    0.24    2.46  INTRA BF
 1106 GLU  ( 527-) B  -    OE2 <-->  1161 ARG  ( 582-) B  -    NH1    0.21    2.49  INTRA BF
  771 ARG  ( 192-) B  -    NH1 <-->   776 GLU  ( 197-) B  -    O      0.20    2.50  INTRA BF
  270 LYS  ( 288-) A  -    NZ  <-->   413 ASP  ( 431-) A  -    CG     0.20    2.90  INTRA BF
 1464 ARG  ( 426-) F  -    O   <-->  1468 ALA  ( 430-) F  -    N      0.20    2.50  INTRA BF
 1224 SER  ( 353-) E  -    O   <-->  1228 ASN  ( 357-) E  -    ND2    0.20    2.50  INTRA BF
   32 TYR  (  50-) A  -    CE2 <-->    44 MET  (  62-) A  -    SD     0.19    3.21  INTRA BF
  664 LEU  (  85-) B  -    CD2 <-->   680 GLN  ( 101-) B  -    NE2    0.19    2.91  INTRA BF
And so on for a total of   140 lines.
 
# 85 # Note: Some notes regarding these bumps
The bumps have been binned in 5 categories ranging from 'please look at'
till 'must fix'. Additionally, the integrated sum of all bumps, the squared
sum of all bumps, and these latter two values normalized by the number of
contacts are listed too for comparison purposes between, for example, small
and large proteins.
 
Total bump value: 13.047
Total bump value per residue: 0.091
Total number of bumps: 140
Total squared bump value: 2.271
Total number of bumps in the mildest bin: 133
Total number of bumps in the second bin: 6
Total number of bumps in the middle bin: 1
Total number of bumps in the fourth bin: 0
Total number of bumps in the worst bin: 0
 
# 86 # Note: Inside/outside distribution check
The following list contains per-residue Z-scores describing how well the
residue's observed accessibility fits the expected one. A positive Z-score
indicates "more exposure than usual", whereas a negative Z-score means
"more buried than usual". The absolute value of the Z-score must be used to
judge the quality. Today WHAT CHECK saw no reason to complain.
 
# 87 # Note: Inside/Outside residue distribution normal
The distribution of residue types over the inside and the outside of the
protein is normal.
 
inside/outside RMS Z-score : 1.035
 
# 88 # Note: Inside/Outside RMS Z-score plot
The Inside/Outside distribution normality RMS Z-score over a 15 residue
window is plotted as function of the residue number. High areas in the plot
(above 1.5) indicate unusual inside/outside patterns.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: A
 
# 89 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: B
 
# 90 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: E
 
# 91 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: F
 
# 92 # Warning: Abnormal packing environment for some residues
The residues listed in the table below have an unusual packing environment.
 
The packing environment of the residues is compared with the average packing
environment for all residues of the same type in good PDB files. A low
packing score can indicate one of several things: Poor packing, misthreading
of the sequence through the density, crystal contacts, contacts with a
co-factor, or the residue is part of the active site. It is not uncommon to
see a few of these, but in any case this requires further inspection of the
residue.
 
 1281 PHE  ( 416-) E  -  -7.11
  866 GLN  ( 287-) B  -  -6.80
  269 GLN  ( 287-) A  -  -6.76
 1454 PHE  ( 416-) F  -  -6.31
   71 GLN  (  89-) A  -  -6.30
 1377 LYS  ( 333-) F  -  -6.18
  668 GLN  (  89-) B  -  -6.15
   68 GLN  (  86-) A  -  -6.03
 1204 LYS  ( 333-) E  -  -6.00
 1529 TYR  ( 491-) F  -  -5.93
 1337 LEU  ( 472-) E  -  -5.90
 1510 LEU  ( 472-) F  -  -5.86
 1115 GLU  ( 536-) B  -  -5.79
  972 ARG  ( 393-) B  -  -5.77
  681 GLN  ( 102-) B  -  -5.70
And so on for a total of    39 lines.
 
# 93 # Warning: Abnormal packing environment for sequential residues
A stretch of at least three sequential residues with a questionable packing
environment was found. This could indicate that these residues are part
of a strange loop. It might also be an indication of misthreading in the
density. However, it can also indicate that one or more residues in this
stretch have other problems such as, for example, missing atoms, very
weird angles or bond lengths, etc.
 
The table below lists the first and last residue in each stretch found,
as well as the average residue score of the series.
 
  320 ASN  ( 338-) A  -      322 --- GLN   340- (A ) -       -4.73
  917 ASN  ( 338-) B  -      919 --- GLN   340- (B ) -       -4.67
 1244 LYS  ( 373-) E  -     1246 --- ASN   375- (E ) -       -4.76
 1417 LYS  ( 373-) F  -     1419 --- ASN   375- (F ) -       -4.85
 
# 94 # Note: Structural average packing environment OK
The structural average packing score is within normal ranges.
 
 
Average for range     1 - 1541 :  -0.361
 
# 95 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: A
 
# 96 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: B
 
# 97 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: E
 
# 98 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: F
 
# 99 # Warning: Low packing Z-score for some residues
The residues listed in the table below have an unusual packing
environment according to the 2nd generation packing check. The score
listed in the table is a packing normality Z-score: positive means
better than average, negative means worse than average. Only residues
scoring less than -2.50 are listed here. These are the unusual
residues in the structure, so it will be interesting to take a
special look at them.
 
  542 LEU  ( 560-) A  -  -2.94
  897 VAL  ( 318-) B  -  -2.56
 
# 100 # Note: No series of residues with abnormal new packing environment
There are no stretches of four or more residues each having a packing
Z-score worse than -1.75.
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
 
# 101 # Note: Second generation quality Z-score plot
The second generation quality Z-score smoothed over a 10 residue window
is plotted as function of the residue number. Low areas in the plot (below
-1.3) indicate unusual packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: A
 
# 102 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: B
 
# 103 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: E
 
# 104 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: F
 
# 105 # Warning: No crystallisation information
No, or very inadequate, crystallisation information was observed upon
reading the PDB file header records. This information should be available
in the form of a series of REMARK 280 lines. Without this information a
few things, such as checking ions in the structure, cannot be performed
optimally.
 
# 106 # Note: Water contacts OK
All water clusters make at least one contact with a non-water atom.
 
# 107 # Note: No waters need moving
All water molecules are sufficiently close to the asymmetric unit given in
the input file.
 
# 108 # Note: Water hydrogen bonds OK
All water molecules can form hydrogen bonds.
 
# 109 # Error: His, Asn, Gln side chain flips
Listed here are Histidine, Asparagine or Glutamine residues for
which the orientation determined from hydrogen bonding analysis are
different from the assignment given in the input. Either they could
form energetically more favourable hydrogen bonds if the terminal
group was rotated by 180 degrees, or there is no assignment in the
input file (atom type 'A') but an assignment could be made. Be aware,
though, that if the topology could not be determined for one or more
ligands, then this option will make errors.
 
   35 ASN  (  53-) A  -
  136 ASN  ( 154-) A  -
  399 HIS  ( 417-) A  -
  616 GLN  (  37-) B  -
  677 GLN  (  98-) B  -
  716 ASN  ( 137-) B  -
  789 ASN  ( 210-) B  -
  917 ASN  ( 338-) B  -
  953 HIS  ( 374-) B  -
 1201 ASN  ( 330-) E  -
 1374 ASN  ( 330-) F  -
 
# 110 # Note: Histidine type assignments
For all complete HIS residues in the structure a tentative assignment to
HIS-D (protonated on ND1), HIS-E (protonated on NE2), or HIS-H (protonated
on both ND1 and NE2, positively charged) is made based on the hydrogen bond
network. A second assignment is made based on which of the Engh and Huber
[REF] histidine geometries fits best to the structure.
 
In the table below all normal histidine residues are listed. The assignment
based on the geometry of the residue is listed first, together with the RMS
Z-score for the fit to the Engh and Huber parameters. For all residues where
the H-bond assignment is different, the assignment is listed in the last
columns, together with its RMS Z-score to the Engh and Huber parameters.
 
As always, the RMS Z-scores should be close to 1.0 if the residues were
restrained to the Engh and Huber parameters during refinement, and if
enough (high resolution) data is available.
 
Please note that because the differences between the geometries of the
different types are small it is possible that the geometric assignment given
here does not correspond to the type used in refinement. This is especially
true if the RMS Z-scores are much higher than 1.0.
 
If the two assignments differ, or the `geometry' RMS Z-score is high, it is
advisable to verify the hydrogen bond assignment, check the HIS type used
during the refinement and possibly adjust it.
 
  177 HIS  ( 195-) A  -   HIS-E   0.44
  210 HIS  ( 228-) A  -   HIS-E   0.63
  221 HIS  ( 239-) A  -   HIS-E   0.49
  223 HIS  ( 241-) A  -   HIS-E   0.48
  247 HIS  ( 265-) A  -   HIS-E   0.50
  327 HIS  ( 345-) A  -   HIS-E   0.54 HIS-D   0.86
  355 HIS  ( 373-) A  -   HIS-E   0.57 HIS-D   0.77
  356 HIS  ( 374-) A  -   HIS-E   0.46 HIS-D   0.83
  360 HIS  ( 378-) A  -   HIS-E   0.66 HIS-D   1.26
  383 HIS  ( 401-) A  -   HIS-E   0.51
  399 HIS  ( 417-) A  -   HIS-E   0.55 HIS-D   0.86
  475 HIS  ( 493-) A  -   HIS-E   0.52 HIS-D   0.65
  487 HIS  ( 505-) A  -   HIS-E   0.58
  517 HIS  ( 535-) A  -   HIS-E   0.51
  522 HIS  ( 540-) A  -   HIS-E   0.39
And so on for a total of    32 lines.
 
# 111 # Warning: Buried unsatisfied hydrogen bond donors
The buried hydrogen bond donors listed in the table below have a hydrogen
atom that is not involved in a hydrogen bond in the optimized hydrogen bond
network.
 
Hydrogen bond donors that are buried inside the protein normally use all of
their hydrogens to form hydrogen bonds within the protein. If there are any
non hydrogen bonded buried hydrogen bond donors in the structure they will
be listed here. In very good structures the number of listed atoms will tend
to zero.
 
Waters are not listed by this option.
 
    2 THR  (  20-) A  -    N
    3 THR  (  21-) A  -    N
    4 GLU  (  22-) A  -    N
    5 GLU  (  23-) A  -    N
    6 LEU  (  24-) A  -    N
   34 THR  (  52-) A  -    N
   39 GLU  (  57-) A  -    N
   40 ASN  (  58-) A  -    N
   42 GLN  (  60-) A  -    N
   68 GLN  (  86-) A  -    N
   70 ILE  (  88-) A  -    N
   89 VAL  ( 107-) A  -    N
  162 TYR  ( 180-) A  -    OH
  180 ASP  ( 198-) A  -    N
  197 TYR  ( 215-) A  -    N
And so on for a total of   140 lines.
 
# 112 # Warning: Buried unsatisfied hydrogen bond acceptors
The buried side-chain hydrogen bond acceptors listed in the table below are
not involved in a hydrogen bond in the optimized hydrogen bond network.
 
Side-chain hydrogen bond acceptors buried inside the protein normally form
hydrogen bonds within the protein. If there are any not hydrogen bonded in
the optimized hydrogen bond network they will be listed here.
 
Waters are not listed by this option.
 
   15 ASN  (  33-) A  -    OD1
   83 GLN  ( 101-) A  -    OE1
  223 HIS  ( 241-) A  -    ND1
  481 ASP  ( 499-) A  -    OD1
  506 GLN  ( 524-) A  -    OE1
  508 GLN  ( 526-) A  -    OE1
  522 HIS  ( 540-) A  -    ND1
  612 ASN  (  33-) B  -    OD1
  820 HIS  ( 241-) B  -    ND1
 1078 ASP  ( 499-) B  -    OD1
 1103 GLN  ( 524-) B  -    OE1
 1105 GLN  ( 526-) B  -    OE1
 
# 113 # Note: Some notes regarding these donors and acceptors
The donors and acceptors have been counted, also as function of their
accessibility. The buried donors and acceptors have been binned in five
categories ranging from not forming any hydrogen bond till forming a poor
till perfect hydrogen bond. Obviously, the buried donors and acceptors
with no or just a poor hydrogen bond should be a topic of concern. As every
protein contains more acceptors than donors, unsatisfied donors are more in
need of attention than unsatisfied acceptors.
 
Total number of donors: 2227
- of which buried: 1148
Total number of acceptors: 2452
- of which buried: 940
Total number of donor+acceptors: 275
  (e.g. the Ser Ogamma that can donate and accept)
- of which buried: 56
Buried donors: 1148
- without H-bond: 133
- essentially without H-bond: 0
- with only a very poor H-bond: 11
- with a poor H-bond: 20
- with a H-bond: 984
Buried acceptors: 940
- without H-bond: 158
- essentially without H-bond: 0
- with only a very poor H-bond: 9
- with a poor H-bond: 34
- with a H-bond: 739
 
# 114 # Note: Content of the PDB file as interpreted by WHAT CHECK
Content of the PDB file as interpreted by WHAT CHECK.
WHAT CHECK has read your PDB file, and stored it internally in what is called
'the soup'. The content of this soup is listed here. An extensive explanation
of all frequently used WHAT CHECK output formats can be found at
swift.cmbi.ru.nl. Look under output formats. A course on reading this
'Molecules' table is part of the WHAT CHECK website.
 
     1     1 (   19)   597 (  615) A Protein             /zata/tempdir/3d0...
     2   598 (   19)  1194 (  615) B Protein             /zata/tempdir/3d0...
     3  1195 (  324)  1246 (  375) E Protein             /zata/tempdir/3d0...
     4  1247 (  382)  1367 (  502) E Protein             /zata/tempdir/3d0...
     5  1368 (  324)  1419 (  375) F Protein             /zata/tempdir/3d0...
     6  1420 (  382)  1540 (  502) F Protein             /zata/tempdir/3d0...
     7  1541 (   91)  1541 (   91) E Sugar<-             /zata/tempdir/3d0...
     8  1542 (  615)  1542 (  615) A D O2 <-   597       /zata/tempdir/3d0...
     9  1543 (  615)  1543 (  615) B D O2 <-  1194       /zata/tempdir/3d0...
    10  1544 (  502)  1544 (  502) E E O2 <-  1367       /zata/tempdir/3d0...
    11  1545 (  502)  1545 (  502) F E O2 <-  1540       /zata/tempdir/3d0...
    12  1546 (  616)  1546 (  616) A NDG                 /zata/tempdir/3d0...
    13  1547 (  901)  1547 (  901) A  ZN                 /zata/tempdir/3d0...
    14  1548 (  902)  1548 (  902) A  CL                 /zata/tempdir/3d0...
    15  1549 (  616)  1549 (  616) B NDG                 /zata/tempdir/3d0...
    16  1550 (  617)  1550 (  617) B NDG                 /zata/tempdir/3d0...
    17  1551 (  618)  1551 (  618) B NDG                 /zata/tempdir/3d0...
    18  1552 (  901)  1552 (  901) B  ZN                 /zata/tempdir/3d0...
    19  1553 (  902)  1553 (  902) B  CL                 /zata/tempdir/3d0...
    20  1554 (   91)  1554 (   91) E NAG  <-             /zata/tempdir/3d0...
    21  1555 (   91)  1555 (   91) F NDG                 /zata/tempdir/3d0...
    22  1556 ( HOH )  1556 ( HOH ) B water   (    1)     /zata/tempdir/3d0...
    23  1557 ( HOH )  1557 ( HOH ) F water   (    1)     /zata/tempdir/3d0...
 
# 115 # Note: Summary report
This is an overall summary of the quality of the structure as compared with
current reliable structures. Numbers in brackets are the average and standard
deviation observed for a large number of files determined with a similar
resolution.
 
The second table mostly gives an impression of how well the model conforms
to common refinement restraint values. These numbers are less than 1.0 if the
spread in data is too little, and larger than 1.0 when the spread is too
large. The former does not need to be a problem, the latter always is bad.
 
 Structure Z-scores, positive is better than average:
  Resolution read from PDB file  :   2.790
  1st generation packing quality :   0.348 (          (  -0.8,  2.5))
  2nd generation packing quality :  -1.334 (          (  -1.7,  1.3))
  Ramachandran plot appearance   :  -4.364 (bad       (  -3.4,  1.7))
  chi-1/chi-2 rotamer normality  :  -3.997 (poor      (  -5.0,  1.9))
  Backbone conformation          :  -0.589 (          (  -1.0,  3.7))
  Inside/Outside distribution    :   1.035
 
 RMS Z-scores, should be close to 1.0:
  Bond lengths                   :   0.391 (tight)
  Bond angles                    :   0.643 (tight)
  Omega angle restraints         :   1.174
  Side chain planarity           :   0.632 (tight)
  Improper dihedral distribution :   0.497
  B-factor distribution          :   0.948
 
# 116 # Note: Introduction to refinement recommendations
First, be aware that the recommendations for crystallographers listed below
are produced by a computer program that was written by a guy who got his
PhD in NMR...
 
We have tried to convert the messages written in this report into a small
set of things you can do with your refinement software to get a better
structure. The things you should do first are listed first. And in some
cases you should first fix that problem, then refine a bit further, and
then run WHAT CHECK again before looking at other problems. If, for example,
WHAT CHECK has found a problem with the SCALE and CRYST cards, then you must
first fix that problem, refine the structure a bit further, and run WHAT
CHECK again because errors in the SCALE and or CRYST card can lead to many
problems elsewhere in the validation process.
 
It is also important to keep in mind that WHAT CHECK is software and that it
occasionally totally misunderstands what is the cause of a problem. But, if
WHAT CHECK lists a problem there normally is a problem albeit that it not
always is the actual problem that gets listed.
 
# 117 # Note: Matthews coefficient problem
WHAT CHECK detected a Matthews coefficient problem. Most times this is an
administrative problem caused by typing the wrong cell multiplicity number
on the CRYST card (or not typing it at all). Occasionally it is caused by
typing the wrong space group on the CRYST card. You better fix this problem,
but normally this problem does not cause WHAT CHECK to give any erroneous
error messages further down in the report.
 
# 118 # Note: Hand problems
Your structure contains several residues with a reported hand problem (a
hand problem means that an atom was found with inverted chirality).
Obviously, things like D-amino acids exist, and if you know that your
molecule has groups with an inverted chirality, you can neglect this
message. If, however, this message comes as a surprise to you, then
you should correct the problems and do some serious refinement again
before you run WHAT CHECK again.
 
# 119 # Error: Bumps in your structure
Upon analysing the bumps in your structure, WHAT CHECK got a bit
worried. Sometimes this means that you have forgotten to lower the
occupancy of overlapping ligands, residues, or water molecules. But,
whatever is the origin of this problem, you have to analyse it and
fix it.
 
# 120 # Note: His, Asn, Gln side chain flips.
His, Asn, and Gln have an asymmetry in their side chain that is hard to
detect unless you have data at much better than 1.0 Angstrom resolution.
WHAT CHECK thinks that your structure contains His, Asn, or Gln residues that
will make better hydrogen bonds when flipped around their chi-2, chi-2, or
chi-3 side chain torsion angle, respectively. You better
check these Asn, His, and Gln residues, and if you use a refinement program
that includes molecular dynamics, then you must (after the
flips were made) refine a bit further before running WHAT CHECK again.
 
# 121 # Warning: Troublesome residues
The residues listed in the table below need to be inspected
 
This table is a very rough attempt to sort the residues according to how
badly they need your attention. The idea is that when you sit in  in front
of the graphics screen and study the residues with the electron density
present that you improve the structure most by dealing with the top residues
in this list first.
 
 1510 LEU  ( 472-) F  -     19.30
 1281 PHE  ( 416-) E  -     14.36
  866 GLN  ( 287-) B  -     13.61
  269 GLN  ( 287-) A  -     13.53
  668 GLN  (  89-) B  -     13.31
   68 GLN  (  86-) A  -     13.18
 1454 PHE  ( 416-) F  -     12.69
   71 GLN  (  89-) A  -     12.60
 1377 LYS  ( 333-) F  -     12.36
 1540 GLU  ( 502-) F  -     12.18
  917 ASN  ( 338-) B  -     12.08
 1439 GLN  ( 401-) F  -     12.07
 1266 GLN  ( 401-) E  -     12.04
 1204 LYS  ( 333-) E  -     12.00
 1529 TYR  ( 491-) F  -     11.86
And so on for a total of   157 lines.
==============
 
 
WHAT IF
    G.Vriend,
      WHAT IF: a molecular modelling and drug design program,
    J. Mol. Graph. 8, 52--56 (1990).
 
WHAT_CHECK (verification routines from WHAT IF)
    R.W.W.Hooft, G.Vriend, C.Sander and E.E.Abola,
      Errors in protein structures
    Nature 381, 272 (1996).
    (see also http://swift.cmbi.ru.nl/gv/whatcheck for a course and extra
    information)
 
PDB facilities
    Touw WG, Baakman C, Black J, te Beek TA, Krieger E, Joosten RP, Vriend G.
      A series of PDB-related databanks for everyday needs.
    Nucleic Acids Research D364-368 Database issue (2015).
 
Bond lengths and angles, protein residues
    R.Engh and R.Huber,
      Accurate bond and angle parameters for X-ray protein structure
      refinement,
    Acta Crystallogr. A47, 392--400 (1991) and
    R.Engh and R.Huber,
    International Tables for Crystallography (2001)
 
 
Bond lengths and angles, DNA/RNA
    G.Parkinson, J.Voitechovsky, L.Clowney, A.T.Bruenger and H.Berman,
      New parameters for the refinement of nucleic acid-containing structures
    Acta Crystallogr. D52, 57--64 (1996).
 
DSSP
    W.Kabsch and C.Sander,
      Dictionary of protein secondary structure: pattern
      recognition of hydrogen bond and geometrical features
    Biopolymers 22, 2577--2637 (1983).
 
Hydrogen bond networks
    R.W.W.Hooft, C.Sander and G.Vriend,
      Positioning hydrogen atoms by optimizing hydrogen bond networks in
      protein structures
    PROTEINS, 26, 363--376 (1996).
 
Matthews' Coefficient
    B.W.Matthews
      Solvent content of Protein Crystals
    J. Mol. Biol. 33, 491--497 (1968).
 
Peptide flips
    Touw WG, Joosten RP, Vriend G.
      Detection of trans-cis flips and peptide-plane flips in protein
      structures.
    Acta Crystallogr D Biological Crystallograhy 71, 1604-1614 (2015).
 
Protein side chain planarity
    R.W.W. Hooft, C. Sander and G. Vriend,
      Verification of protein structures: side-chain planarity
    J. Appl. Cryst. 29, 714--716 (1996).
 
Puckering parameters
    D.Cremer and J.A.Pople,
      A general definition of ring puckering coordinates
    J. Am. Chem. Soc. 97, 1354--1358 (1975).
 
Quality Control
    G.Vriend and C.Sander,
      Quality control of protein models: directional atomic
      contact analysis,
    J. Appl. Cryst. 26, 47--60 (1993).
 
Ramachandran plot
    G.N.Ramachandran, C.Ramakrishnan and V.Sasisekharan,
      Stereochemistry of Polypeptide Chain Conformations
    J. Mol. Biol. 7, 95--99 (1963).
    R.W.W. Hooft, C.Sander and G.Vriend,
      Objectively judging the quality of a protein structure from a
      Ramachandran plot
    CABIOS (1997), 13, 425--430.
 
Symmetry Checks
    R.W.W.Hooft, C.Sander and G.Vriend,
      Reconstruction of symmetry related molecules from protein
      data bank (PDB) files
    J. Appl. Cryst. 27, 1006--1009 (1994).
 
Tau angle
    W.G.Touw and G.Vriend
      On the complexity of Engh and Huber refinement restraints: the angle
      tau as example.
    Acta Crystallogr D 66, 1341--1350 (2010).
 
Ion Checks
    I.D.Brown and K.K.Wu,
      Empirical Parameters for Calculating Cation-Oxygen Bond Valences
    Acta Cryst. B32, 1957--1959 (1975).
 
    M.Nayal and E.Di Cera,
      Valence Screening of Water in Protein Crystals Reveals Potential Na+
      Binding Sites
    J.Mol.Biol. 256 228--234 (1996).
 
    P.Mueller, S.Koepke and G.M.Sheldrick,
      Is the bond-valence method able to identify metal atoms in protein
      structures?
    Acta Cryst. D 59 32--37 (2003).
 
Checking checks
    K.Wilson, C.Sander, R.W.W.Hooft, G.Vriend, et al.
      Who checks the checkers
    J.Mol.Biol. (1998) 276,417-436.
==============
 
 
WHAT IF
    G.Vriend,
      WHAT IF: a molecular modelling and drug design program,
    J. Mol. Graph. 8, 52--56 (1990).
 
WHAT_CHECK (verification routines from WHAT IF)
    R.W.W.Hooft, G.Vriend, C.Sander and E.E.Abola,
      Errors in protein structures
    Nature 381, 272 (1996).
    (see also http://swift.cmbi.ru.nl/gv/whatcheck for a course and extra
    information)
 
PDB facilities
    Touw WG, Baakman C, Black J, te Beek TA, Krieger E, Joosten RP, Vriend G.
      A series of PDB-related databanks for everyday needs.
    Nucleic Acids Research D364-368 Database issue (2015).
 
Bond lengths and angles, protein residues
    R.Engh and R.Huber,
      Accurate bond and angle parameters for X-ray protein structure
      refinement,
    Acta Crystallogr. A47, 392--400 (1991) and
    R.Engh and R.Huber,
    International Tables for Crystallography (2001)
 
 
Bond lengths and angles, DNA/RNA
    G.Parkinson, J.Voitechovsky, L.Clowney, A.T.Bruenger and H.Berman,
      New parameters for the refinement of nucleic acid-containing structures
    Acta Crystallogr. D52, 57--64 (1996).
 
DSSP
    W.Kabsch and C.Sander,
      Dictionary of protein secondary structure: pattern
      recognition of hydrogen bond and geometrical features
    Biopolymers 22, 2577--2637 (1983).
 
Hydrogen bond networks
    R.W.W.Hooft, C.Sander and G.Vriend,
      Positioning hydrogen atoms by optimizing hydrogen bond networks in
      protein structures
    PROTEINS, 26, 363--376 (1996).
 
Matthews' Coefficient
    B.W.Matthews
      Solvent content of Protein Crystals
    J. Mol. Biol. 33, 491--497 (1968).
 
Peptide flips
    Touw WG, Joosten RP, Vriend G.
      Detection of trans-cis flips and peptide-plane flips in protein
      structures.
    Acta Crystallogr D Biological Crystallograhy 71, 1604-1614 (2015).
 
Protein side chain planarity
    R.W.W. Hooft, C. Sander and G. Vriend,
      Verification of protein structures: side-chain planarity
    J. Appl. Cryst. 29, 714--716 (1996).
 
Puckering parameters
    D.Cremer and J.A.Pople,
      A general definition of ring puckering coordinates
    J. Am. Chem. Soc. 97, 1354--1358 (1975).
 
Quality Control
    G.Vriend and C.Sander,
      Quality control of protein models: directional atomic
      contact analysis,
    J. Appl. Cryst. 26, 47--60 (1993).
 
Ramachandran plot
    G.N.Ramachandran, C.Ramakrishnan and V.Sasisekharan,
      Stereochemistry of Polypeptide Chain Conformations
    J. Mol. Biol. 7, 95--99 (1963).
    R.W.W. Hooft, C.Sander and G.Vriend,
      Objectively judging the quality of a protein structure from a
      Ramachandran plot
    CABIOS (1997), 13, 425--430.
 
Symmetry Checks
    R.W.W.Hooft, C.Sander and G.Vriend,
      Reconstruction of symmetry related molecules from protein
      data bank (PDB) files
    J. Appl. Cryst. 27, 1006--1009 (1994).
 
Tau angle
    W.G.Touw and G.Vriend
      On the complexity of Engh and Huber refinement restraints: the angle
      tau as example.
    Acta Crystallogr D 66, 1341--1350 (2010).
 
Ion Checks
    I.D.Brown and K.K.Wu,
      Empirical Parameters for Calculating Cation-Oxygen Bond Valences
    Acta Cryst. B32, 1957--1959 (1975).
 
    M.Nayal and E.Di Cera,
      Valence Screening of Water in Protein Crystals Reveals Potential Na+
      Binding Sites
    J.Mol.Biol. 256 228--234 (1996).
 
    P.Mueller, S.Koepke and G.M.Sheldrick,
      Is the bond-valence method able to identify metal atoms in protein
      structures?
    Acta Cryst. D 59 32--37 (2003).
 
Checking checks
    K.Wilson, C.Sander, R.W.W.Hooft, G.Vriend, et al.
      Who checks the checkers
    J.Mol.Biol. (1998) 276,417-436.
