************************************************************************
********** REPORT OF PROTEIN ANALYSIS  by the WHAT IF program **********
************************************************************************

Date : 2025-02-17
This report was created by WHAT IF version WHATCHECK15.0

This document is a WHAT_CHECK 14.0 report for a PDB-file. Each reported
fact has an assigned severity, one of:

error  : Items marked as errors are considered severe problems requiring
         immediate attention.
warning: Either less severe problems or uncommon structural features. These
         still need special attention.
note   : Statistical values, plots, or other verbose results of tests and
         analyses that have been performed.

If alternate conformations are present, only the first is evaluated. Hydrogen
atoms are only included if explicitly requested, and even then they are not
used in all checks. The software functions less well for non-canonical amino
acids and exotic ligands than for the 20 canonical residues and canonical
nucleic acids.

Some remarks regarding the output:

Residues/atoms in tables are normally given in a few parts:

A number. This is the internal sequence number of the residue used by WHAT IF.
    The first residues in the file get number 1, 2, etc.
The residue type. Normally this is a three letter amino acid type.
The sequence number, between brackets. This is the residue number as it was
    given in the input file. It can be followed by the insertion code.
The chain identifier. A single character. If no chain identifier was given in
    the input file, this will be a minus sign or a blank.
A model number. If no model number exists, like in most X-ray files, this will
    be a blank or occasionally a minus sign.
In case an atom is part of the output, the atom will be listed using the PDB
    nomenclature for type and identifier.

To indicate the normality of a score, the score may be expressed as a Z-value
   or Z-score. This is just the number of standard deviations that the score
   deviates from the expected value. A property of Z-values is that the
   root-mean-square of a group of Z-values (the RMS Z-value) is expected to be
   1.0. Z-values above 4.0 and below -4.0 are very uncommon. If a Z-score is
   used in WHAT IF, the accompanying text will explain how the expected value
   and standard deviation were obtained.
The names of nucleic acids are DGUA, DTHY, OCYT, OADE, etc. The first character
   is a D or O for DNA or RNA respectively. This circumvents ambiguities in the
   many old PDB files in which DNA and RNA were both called A, C, G, and T.



=========================================
==== Compound code /zata/tempdir/1sl6/wctemp_besttls/1sl6_besttls.pd====
=========================================
 
# 1 # Note: Introduction
WHAT CHECK needs to read a PDB file before it can check it. It does a
series of checks upon reading the file. The results of these checks are
reported in this section (section 2.1). The rest of the report will be more
systematic in that section 2.2 reports on administrative problems. Section
2.3 gives descriptive output that is not directly validating things but
more telling you how WHAT CHECK interpreted the input file. Section 2.4
looks at B-factors, occupancies, and the presence/absence of (spurious)
atoms. Section 2.5 deals with nomenclature problems. Section 2.6 deals with
geometric problems like bond lengths and bond angles. Section 2.7 deals with
torsion angle issues. Section 2.8 looks at atomic clashes. Section 2.9 deals
with packing, accessibility, etc, issues. Section 2.10 deals with hydrogen
bonds, ion packing, and other things that can be summarized under the common
name charge-charge interactions. Section 2.11 gives a summary of whole report
and tells you (if applicable) which symmetry matrices were used. Section 2.12
tells the crystallographer which are the things most in need of manual
correction. And the last section, section 2.13, lists all residues sorted
by their need for visual inspection in light of the electron density.
WARNING. Date error on HEADER card:
HEADER                                                        1SL6
ATOM  *****  O   HOH A 401     103.002  36.563  71.309  1.00 52.03       401 O
ATOM  *****  O   HOH A 402     100.326  38.227  72.035  1.00 51.03       402 O
ATOM  *****  O   HOH A 403      86.627  20.094  56.380  1.00 38.93       403 O
ATOM  *****  O   HOH A 404     112.967  25.530  49.452  1.00 34.90       404 O
ATOM  *****  O   HOH A 405     115.087  20.519  54.448  1.00 34.60       405 O
ATOM  *****  O   HOH A 406     101.800  38.201  53.332  1.00 39.73       406 O
ATOM  *****  O   HOH A 407     105.464  16.370  61.471  1.00 39.76       407 O
ATOM  *****  O   HOH A 408     114.985  25.227  53.560  1.00 36.16       408 O
ATOM  *****  O   HOH A 409     108.154  14.287  54.341  1.00 41.31       409 O
ATOM  *****  O   HOH A 410     105.701  13.605  54.468  1.00 37.05       410 O
ATOM  *****  O   HOH A 411     109.229  16.063  56.000  1.00 43.75       411 O
ATOM  *****  O   HOH A 412     111.431  15.355  52.497  1.00 44.07       412 O
ATOM  *****  O   HOH A 413      96.977  19.551  66.039  1.00 43.69       413 O
ATOM  *****  O   HOH A 414     108.131  19.371  46.910  1.00 39.53       414 O
ATOM  *****  O   HOH A 415      93.858   1.852  53.820  1.00 83.56       415 O
ATOM  *****  O   HOH A 416      98.061  -4.008  52.831  1.00 59.37       416 O
ATOM  *****  O   HOH A 417     100.605  19.626  41.234  1.00 39.49       417 O
ATOM  *****  O   HOH A 418      98.737  18.563  68.228  1.00 40.60       418 O
ATOM  *****  O   HOH A 419     116.039  30.303  55.356  1.00 39.69       419 O
ATOM  *****  O   HOH A 420     102.634  17.353  62.152  1.00 41.51       420 O
ATOM  *****  O   HOH A 421      86.831  28.557  64.629  1.00 36.30       421 O
ATOM  *****  O   HOH A 422      97.232  20.673  43.499  1.00 45.37       422 O
ATOM  *****  O   HOH A 423      91.291  31.020  51.672  1.00 44.45       423 O
ATOM  *****  O   HOH A 424      93.721   8.012  50.656  1.00 49.55       424 O
ATOM  *****  O   HOH A 425     125.363   9.867  56.079  1.00 76.86       425 O
ATOM  *****  O   HOH A 426      83.555  26.114  58.888  1.00 51.46       426 O
ATOM  *****  O   HOH A 427      85.729  34.469  59.439  1.00 42.05       427 O
ATOM  *****  O   HOH A 428      97.232  36.009  54.197  1.00 72.81       428 O
ATOM  *****  O   HOH A 429     109.838  17.759  69.251  1.00 63.36       429 O
ATOM  *****  O   HOH A 430     114.685  30.915  62.883  1.00 58.16       430 O
ATOM  *****  O   HOH A 431     108.860  33.105  50.247  1.00 56.20       431 O
ATOM  *****  O   HOH A 432     106.657  37.493  49.290  1.00 48.42       432 O
ATOM  *****  O   HOH A 433      88.300  33.392  56.229  1.00 54.95       433 O
ATOM  *****  O   HOH A 434      91.075  31.513  54.620  1.00 49.36       434 O
ATOM  *****  O   HOH A 435      91.701  23.112  51.784  1.00 46.82       435 O
ATOM  *****  O   HOH A 436     113.966  13.575  49.106  1.00 58.15       436 O
ATOM  *****  O   HOH A 437     109.158  11.687  55.465  1.00 55.03       437 O
ATOM  *****  O   HOH A 438      92.786  30.574  67.170  1.00 64.68       438 O
ATOM  *****  O   HOH A 439      88.664  28.944  69.581  1.00 58.87       439 O
ATOM  *****  O   HOH A 440      97.689   8.983  63.809  1.00 55.31       440 O
ATOM  *****  O   HOH A 441     111.713  24.184  61.814  1.00 47.50       441 O
ATOM  *****  O   HOH D 401      93.209  23.918  25.251  1.00 30.64       401 O
ATOM  *****  O   HOH D 402      97.183  20.122  20.820  1.00 32.41       402 O
ATOM  *****  O   HOH D 403      94.512  23.082  38.596  1.00 47.29       403 O
ATOM  *****  O   HOH D 404      91.629  26.284  37.317  1.00 61.67       404 O
ATOM  *****  O   HOH D 405     104.192  11.841  39.901  1.00 34.77       405 O
ATOM  *****  O   HOH D 406     105.338  15.652  34.686  1.00 38.30       406 O
ATOM  *****  O   HOH D 407     102.865  19.705  39.597  1.00 38.11       407 O
ATOM  *****  O   HOH D 408     101.367  32.007  28.848  1.00 55.99       408 O
ATOM  *****  O   HOH D 409      99.830  17.892  21.451  1.00 34.97       409 O
ATOM  *****  O   HOH D 410     103.798  11.461  36.503  1.00 39.70       410 O
ATOM  *****  O   HOH D 411      99.546  20.240  27.516  1.00 32.82       411 O
ATOM  *****  O   HOH D 412      90.157  22.256  16.529  1.00 36.77       412 O
ATOM  *****  O   HOH D 413      89.735  27.041  35.602  1.00 42.82       413 O
ATOM  *****  O   HOH D 414     104.398  18.346  41.414  1.00 30.58       414 O
ATOM  *****  O   HOH D 415      78.899   4.694  35.795  1.00 40.46       415 O
ATOM  *****  O   HOH D 416      93.730   4.781  30.647  1.00 37.39       416 O
ATOM  *****  O   HOH D 417      86.056  20.053  20.528  1.00 47.07       417 O
ATOM  *****  O   HOH D 418      94.401  18.947  44.314  1.00 43.23       418 O
ATOM  *****  O   HOH D 419      93.256  14.456  21.622  1.00 39.04       419 O
ATOM  *****  O   HOH D 420      95.276  28.760  22.099  1.00 45.09       420 O
ATOM  *****  O   HOH D 421      92.425  16.064  19.587  1.00 37.86       421 O
ATOM  *****  O   HOH D 422      74.758   3.623  41.817  1.00 49.86       422 O
ATOM  *****  O   HOH D 423      92.131  12.284  24.609  1.00 42.40       423 O
ATOM  *****  O   HOH D 424      85.141  25.705  24.029  1.00 39.21       424 O
ATOM  *****  O   HOH D 425      77.061  12.862  24.104  1.00 69.61       425 O
ATOM  *****  O   HOH D 426      81.394  13.688  24.903  1.00 51.62       426 O
ATOM  *****  O   HOH D 427      93.013   3.984  27.838  1.00 33.40       427 O
ATOM  *****  O   HOH D 428      86.533   5.271  31.055  1.00 39.26       428 O
ATOM  *****  O   HOH D 429      95.371   3.497  38.392  1.00 43.86       429 O
ATOM  *****  O   HOH D 430     102.462   7.223  41.259  1.00 45.20       430 O
ATOM  *****  O   HOH D 431     101.713  13.874  30.510  1.00 52.42       431 O
ATOM  *****  O   HOH D 432      92.252   1.781  29.013  1.00 65.86       432 O
ATOM  *****  O   HOH D 433      75.098  18.334  35.310  1.00 54.30       433 O
ATOM  *****  O   HOH D 434      89.073  21.162  42.765  1.00 46.68       434 O
ATOM  *****  O   HOH D 435      82.820  -7.044  34.302  1.00 55.15       435 O
ATOM  *****  O   HOH D 436     102.367  18.364  43.295  1.00 50.82       436 O
ATOM  *****  O   HOH B 401     139.958  52.619  26.292  1.00 37.09       401 O
ATOM  *****  O   HOH B 402     141.493  53.587  28.882  1.00 40.89       402 O
ATOM  *****  O   HOH B 403     140.854  27.205  36.797  1.00 38.34       403 O
ATOM  *****  O   HOH B 404     120.454  36.191  20.002  1.00 32.02       404 O
ATOM  *****  O   HOH B 405     124.941  34.577  13.998  1.00 43.65       405 O
ATOM  *****  O   HOH B 406     125.167  45.098  33.716  1.00 45.45       406 O
ATOM  *****  O   HOH B 407     136.699  32.108  17.969  1.00 44.88       407 O
ATOM  *****  O   HOH B 408     122.895  38.587  16.875  1.00 47.78       408 O
ATOM  *****  O   HOH B 409     130.199  27.734  17.302  1.00 43.61       409 O
ATOM  *****  O   HOH B 410     131.817  26.471  18.964  1.00 36.39       410 O
ATOM  *****  O   HOH B 411     130.535  30.160  16.496  1.00 42.12       411 O
ATOM  *****  O   HOH B 412     126.985  28.883  15.581  1.00 42.76       412 O
ATOM  *****  O   HOH B 413     143.597  34.334  25.226  1.00 41.13       413 O
ATOM  *****  O   HOH B 414     122.620  28.308  21.923  1.00 39.86       414 O
ATOM  *****  O   HOH B 415     138.472  12.416  23.634  1.00 70.00       415 O
ATOM  *****  O   HOH B 416     138.949   8.112  17.665  1.00 74.78       416 O
ATOM  *****  O   HOH B 417     144.687  35.299  22.593  1.00 39.54       417 O
ATOM  *****  O   HOH B 418     133.257  28.711  35.430  1.00 42.62       418 O
ATOM  *****  O   HOH B 419     140.574  46.830  22.383  1.00 38.08       419 O
ATOM  *****  O   HOH B 420     133.204  36.305  38.858  1.00 43.58       420 O
ATOM  *****  O   HOH B 421     144.590  37.867  38.182  1.00 46.55       421 O
ATOM  *****  O   HOH B 422     132.777  30.708  33.366  1.00 44.10       422 O
ATOM  *****  O   HOH B 423     149.495  37.262  32.989  1.00 44.64       423 O
ATOM  *****  O   HOH B 424     132.564  51.662  25.552  1.00 52.36       424 O
ATOM  *****  O   HOH B 425     131.836  40.639  16.332  1.00 46.84       425 O
ATOM  *****  O   HOH B 426     122.904  44.420  17.604  1.00 48.77       426 O
ATOM  *****  O   HOH B 427     120.619  39.944  16.225  1.00 49.32       427 O
ATOM  *****  O   HOH B 428     120.523  41.858  26.741  1.00 52.51       428 O
ATOM  *****  O   HOH B 429     139.398  48.737  32.557  1.00 42.19       429 O
ATOM  *****  O   HOH B 430     131.978  40.718  37.939  1.00 51.73       430 O
ATOM  *****  O   HOH B 431     133.535  38.889  40.131  1.00 68.01       431 O
ATOM  *****  O   HOH B 432     128.284  24.361  30.521  1.00 43.30       432 O
ATOM  *****  O   HOH B 433     126.696  42.675  12.025  1.00 64.65       433 O
ATOM  *****  O   HOH C  18      81.449  55.949  19.364  1.00 38.81        18 O
ATOM  *****  O   HOH C 100      95.576  39.718   2.411  1.00 42.91       100 O
ATOM  *****  O   HOH C 101      89.819  32.712  29.016  1.00 37.23       101 O
ATOM  *****  O   HOH C 102      83.293  30.267  26.435  1.00 48.38       102 O
ATOM  *****  O   HOH C 107      96.473  48.294  25.060  1.00 47.74       107 O
ATOM  *****  O   HOH C 110      80.980  33.814  14.381  1.00 49.53       110 O
ATOM  *****  O   HOH C 114      85.615  34.306  29.298  1.00 46.11       114 O
ATOM  *****  O   HOH C 115      85.141  27.763  18.022  1.00 48.67       115 O
ATOM  *****  O   HOH C 118      86.135  27.914  15.545  1.00 45.87       118 O
ATOM  *****  O   HOH C 124      85.354  27.989  25.497  1.00 45.11       124 O
ATOM  *****  O   HOH C 125      83.632  29.711  19.090  1.00 46.64       125 O
ATOM  *****  O   HOH C 128      85.059  26.955  21.659  1.00 48.74       128 O
ATOM  *****  O   HOH C 129      82.885  41.243   7.797  1.00 40.39       129 O
ATOM  *****  O   HOH C 130      92.607  28.006  22.873  1.00 42.51       130 O
ATOM  *****  O   HOH C 134      89.661  22.324   0.858  1.00 68.06       134 O
ATOM  *****  O   HOH C 137      74.448  13.242  26.090  1.00 60.32       137 O
ATOM  *****  O   HOH C 138      96.578  28.979   7.751  1.00 58.52       138 O
ATOM  *****  O   HOH C 139      91.883  24.955  22.993  1.00 52.63       139 O
ATOM  *****  O   HOH C 140      83.366  58.671  21.289  1.00 41.53       140 O
ATOM  *****  O   HOH C 147      80.187  41.170   7.986  1.00 39.07       147 O
ATOM  *****  O   HOH C 158      79.204  49.683  17.187  1.00 44.14       158 O
ATOM  *****  O   HOH C 197      98.427  38.349   9.625  1.00 53.12       197 O
ATOM  *****  O   HOH C 198      92.057  50.601   4.570  1.00 56.50       198 O
ATOM  *****  O   HOH C 199      99.789  41.674  18.907  1.00 53.13       199 O
ATOM  *****  O   HOH C 200      80.070  46.848  25.610  1.00 57.99       200 O
ATOM  *****  O   HOH C 201      85.715  34.472  32.068  1.00 47.42       201 O
ATOM  *****  O   HOH C 202      87.814  55.113  16.251  1.00 44.98       202 O
ATOM  *****  O   HOH E 401     106.393  13.133  39.988  1.00 29.35       401 O
ATOM  *****  O   HOH E 402     120.939  23.709  37.899  1.00 44.22       402 O
ATOM  *****  O   HOH E 403     121.137  24.383  41.904  1.00 52.28       403 O
ATOM  *****  O   HOH E 404     117.486  19.280  25.185  1.00 33.41       404 O
ATOM  *****  O   HOH E 405     118.586  15.375  25.263  1.00 33.51       405 O
ATOM  *****  O   HOH E 406     110.862  17.303  35.899  1.00 30.90       406 O
ATOM  *****  O   HOH E 407     105.890  10.879  48.026  1.00 33.01       407 O
ATOM  *****  O   HOH E 408     120.300  23.928  44.542  1.00 34.23       408 O
ATOM  *****  O   HOH E 409     120.408  23.632  26.329  1.00 34.57       409 O
ATOM  *****  O   HOH E 410     132.639   2.683  42.368  1.00 37.13       410 O
ATOM  *****  O   HOH E 411     121.031   4.474  32.422  1.00 32.21       411 O
ATOM  *****  O   HOH E 412     112.053   9.876  48.825  1.00 46.82       412 O
ATOM  *****  O   HOH E 413     127.109  22.850  33.860  1.00 36.00       413 O
ATOM  *****  O   HOH E 414     110.722   7.892  40.302  1.00 37.73       414 O
ATOM  *****  O   HOH E 415     121.593  23.749  29.982  1.00 32.47       415 O
ATOM  *****  O   HOH E 416     106.035  20.696  45.391  1.00 41.13       416 O
ATOM  *****  O   HOH E 417     114.370  18.509  51.642  1.00 37.52       417 O
ATOM  *****  O   HOH E 418     109.017   7.869  42.317  1.00 35.81       418 O
ATOM  *****  O   HOH E 419     139.673   3.242  43.392  1.00 40.89       419 O
ATOM  *****  O   HOH E 420     114.683   7.110  38.842  1.00 48.10       420 O
ATOM  *****  O   HOH E 421     113.738  15.816  51.366  1.00 38.40       421 O
ATOM  *****  O   HOH E 422     121.902   3.031  51.911  1.00 56.21       422 O
ATOM  *****  O   HOH E 423     120.039   5.648  48.462  1.00 38.71       423 O
ATOM  *****  O   HOH E 424     121.210  17.521  23.915  1.00 41.07       424 O
ATOM  *****  O   HOH E 425     115.037  18.501  26.549  1.00 38.95       425 O
ATOM  *****  O   HOH E 426     119.105  23.509  28.939  1.00 38.33       426 O
ATOM  *****  O   HOH E 427     109.019  15.554  35.085  1.00 45.15       427 O
ATOM  *****  O   HOH E 428     106.178  12.357  36.633  1.00 33.92       428 O
ATOM  *****  O   HOH E 429     108.900  16.929  45.932  1.00 64.03       429 O
ATOM  *****  O   HOH E 430     119.175   2.199  33.326  1.00 32.32       430 O
ATOM  *****  O   HOH E 431     117.549  25.605  47.432  1.00 39.33       431 O
ATOM  *****  O   HOH E 432     121.196  25.630  48.457  1.00 34.30       432 O
ATOM  *****  O   HOH E 433     126.062  20.499  25.615  1.00 34.79       433 O
ATOM  *****  O   HOH E 434     106.967  23.310  44.170  1.00 45.85       434 O
ATOM  *****  O   HOH E 435     124.744  21.569  32.801  1.00 43.89       435 O
ATOM  *****  O   HOH E 436     121.369  25.929  45.827  1.00 44.27       436 O
ATOM  *****  O   HOH E 437     121.290  12.027  55.552  1.00 41.50       437 O
ATOM  *****  O   HOH E 438     133.041  20.582  30.357  1.00 48.73       438 O
ATOM  *****  O   HOH E 439     125.181  21.659  49.348  1.00 48.33       439 O
ATOM  *****  O   HOH E 440     134.839  10.268  31.605  1.00 48.08       440 O
ATOM  *****  O   HOH E 441     125.035  15.918  23.914  1.00 53.11       441 O
ATOM  *****  O   HOH E 442     122.932  23.837  27.501  1.00 40.98       442 O
ATOM  *****  O   HOH E 443     128.912  20.099  41.152  1.00 44.93       443 O
ATOM  *****  O   HOH E 444     106.451  24.526  41.602  1.00 46.73       444 O
ATOM  *****  O   HOH E 445     126.202  23.875  46.800  1.00 72.18       445 O
ATOM  *****  O   HOH E 446     115.356  24.653  34.746  1.00 52.61       446 O
ATOM  *****  O   HOH E 447     109.233  13.903  33.078  1.00 50.43       447 O
ATOM  *****  O   HOH E 448     128.036  21.754  39.813  1.00 50.23       448 O
ATOM  *****  O   HOH F 401     119.438  19.432  22.856  1.00 31.48       401 O
ATOM  *****  O   HOH F 402     107.484  31.244  16.212  1.00 37.28       402 O
ATOM  *****  O   HOH F 403     110.559  33.852  15.768  1.00 48.10       403 O
ATOM  *****  O   HOH F 404     100.125  20.501  21.528  1.00 29.27       404 O
ATOM  *****  O   HOH F 405     114.002  19.602  23.454  1.00 43.59       405 O
ATOM  *****  O   HOH F 406     117.172  17.008  23.549  1.00 38.43       406 O
ATOM  *****  O   HOH F 407     100.782  17.681  18.751  1.00 35.97       407 O
ATOM  *****  O   HOH F 408     112.869  22.355  22.559  1.00 33.61       408 O
ATOM  *****  O   HOH F 409     127.167  21.094  19.426  1.00 28.96       409 O
ATOM  *****  O   HOH F 410     113.203  34.489  15.053  1.00 45.61       410 O
ATOM  *****  O   HOH F 411      98.559  25.481  21.060  1.00 33.24       411 O
ATOM  *****  O   HOH F 412     111.696  19.406  -4.621  1.00 43.13       412 O
ATOM  *****  O   HOH F 413     108.785  12.639   9.417  1.00 32.65       413 O
ATOM  *****  O   HOH F 414     125.257  22.646  13.480  1.00 47.94       414 O
ATOM  *****  O   HOH F 415     101.556  30.493  12.262  1.00 39.82       415 O
ATOM  *****  O   HOH F 416     119.115  16.168  16.410  1.00 43.76       416 O
ATOM  *****  O   HOH F 417     100.850  27.768  18.592  1.00 37.34       417 O
ATOM  *****  O   HOH F 418     122.056  27.919  24.620  1.00 37.24       418 O
ATOM  *****  O   HOH F 419     123.815  31.700  15.058  1.00 33.43       419 O
ATOM  *****  O   HOH F 420     121.795  16.798  17.253  1.00 40.16       420 O
ATOM  *****  O   HOH F 421     108.610  22.548 -10.249  1.00 53.33       421 O
ATOM  *****  O   HOH F 422     116.333  16.252  13.392  1.00 47.45       422 O
ATOM  *****  O   HOH F 423     124.352  29.222  14.297  1.00 41.10       423 O
ATOM  *****  O   HOH F 424     124.790  20.785   0.977  1.00 59.63       424 O
ATOM  *****  O   HOH F 425     122.002  20.807   5.247  1.00 59.23       425 O
ATOM  *****  O   HOH F 426      98.026  19.603  18.110  1.00 38.23       426 O
ATOM  *****  O   HOH F 427     102.927  20.041  22.929  1.00 38.78       427 O
ATOM  *****  O   HOH F 428     101.287  26.610  21.078  1.00 44.20       428 O
ATOM  *****  O   HOH F 429     110.832  10.731   9.408  1.00 35.98       429 O
ATOM  *****  O   HOH F 430      98.232  27.169  18.551  1.00 43.72       430 O
ATOM  *****  O   HOH F 431     122.234  26.121  20.417  1.00 43.31       431 O
ATOM  *****  O   HOH F 432     102.167  28.035  14.259  1.00 44.09       432 O
ATOM  *****  O   HOH F 433     103.036  25.858   6.107  1.00 44.57       433 O
ATOM  *****  O   HOH F 434     101.775  27.137   4.181  1.00 53.39       434 O
ATOM  *****  O   HOH F 435      99.663  21.396   0.874  1.00 56.75       435 O
ATOM  *****  O   HOH F 436      95.661  24.243  15.154  1.00 45.92       436 O
ATOM  *****  O   HOH F 437      96.233  19.718  14.067  1.00 56.40       437 O
ATOM  *****  O   HOH F 438     107.349  17.627  20.202  1.00 50.81       438 O
ATOM  *****  O   HOH F 439     101.118  15.621  21.894  1.00 53.52       439 O
ATOM  *****  O   HOH F 440     122.305  20.032   0.667  1.00 49.47       440 O
ATOM  *****  O   HOH F 441     107.002  32.308   7.248  1.00 45.60       441 O
ATOM  *****  O   HOH F 442     122.827  27.671   0.165  1.00 54.45       442 O
ATOM  *****  O   HOH F 443     117.831  35.112   6.856  1.00 47.33       443 O
ATOM  *****  O   HOH F 444     125.336  30.200   5.211  1.00 47.46       444 O
ATOM  *****  O   HOH F 445     106.128  32.992   9.132  1.00 45.85       445 O
ATOM  *****  C2  NDG G   1      95.807  45.253  56.695  1.00 98.52       C2  C
ATOM  *****  C3  NDG G   1      96.651  44.406  55.733  1.00102.59       C3  C
ATOM  *****  C4  NDG G   1      95.838  44.096  54.473  1.00111.66       C4  C
ATOM  *****  C5  NDG G   1      95.461  45.431  53.826  1.00105.00       C5  C
ATOM  *****  C6  NDG G   1      94.744  45.317  52.492  1.00 96.88       C6  C
ATOM  *****  C7  NDG G   1      96.283  45.489  59.097  1.00 98.56       C7  C
ATOM  *****  C8  NDG G   1      96.822  46.453  60.113  1.00 87.70       C8  C
ATOM  *****  O5  NDG G   1      94.587  46.154  54.723  1.00103.24       O5  O
ATOM  *****  O3  NDG G   1      97.154  43.191  56.358  1.00 92.48       O3  O
ATOM  *****  O4  NDG G   1      96.594  43.275  53.545  1.00115.44       O4  O
ATOM  *****  O6  NDG G   1      93.828  44.230  52.459  1.00 95.35       O6  O
ATOM  *****  O7  NDG G   1      95.608  44.517  59.418  1.00 97.15       O7  O
ATOM  *****  N2  NDG G   1      96.584  45.739  57.819  1.00101.92       N2  N
ATOM  *****  C2  GAL G   3      97.127  41.582  51.986  1.00 96.13       C2  C
ATOM  *****  C3  GAL G   3      96.939  40.135  51.578  1.00100.30       C3  C
ATOM  *****  C4  GAL G   3      97.010  39.219  52.792  1.00 98.77       C4  C
ATOM  *****  C5  GAL G   3      96.023  39.692  53.867  1.00 94.31       C5  C
ATOM  *****  C6  GAL G   3      96.091  38.874  55.145  1.00 89.39       C6  C
ATOM  *****  O2  GAL G   3      96.924  42.420  50.852  1.00 88.91       O2  O
ATOM  *****  O3  GAL G   3      97.950  39.801  50.625  1.00104.84       O3  O
ATOM  *****  O4  GAL G   3      98.346  39.215  53.317  1.00 92.77       O4  O
ATOM  *****  O5  GAL G   3      96.331  41.060  54.217  1.00 96.13       O5  O
ATOM  *****  O6  GAL G   3      95.069  39.221  56.081  1.00 79.37       O6  O
ATOM  *****  C2  NDG H   1     129.162  50.743  40.774  0.50 58.53       C2  C
ATOM  *****  C3  NDG H   1     128.150  49.847  40.059  0.50 58.83       C3  C
ATOM  *****  C4  NDG H   1     127.776  48.688  40.970  0.50 63.40       C4  C
ATOM  *****  C5  NDG H   1     127.295  49.223  42.320  0.50 62.52       C5  C
ATOM  *****  C6  NDG H   1     127.176  48.137  43.374  0.50 59.00       C6  C
ATOM  *****  C7  NDG H   1     131.068  51.951  39.838  0.50 55.39       C7  C
ATOM  *****  C8  NDG H   1     131.588  53.351  39.971  0.50 47.34       C8  C
ATOM  *****  O5  NDG H   1     128.222  50.195  42.853  0.50 60.48       O5  O
ATOM  *****  O3  NDG H   1     128.603  49.307  38.816  0.50 48.35       O3  O
ATOM  *****  O4  NDG H   1     126.758  47.917  40.290  0.50 66.55       O4  O
ATOM  *****  O6  NDG H   1     127.681  46.868  42.929  0.50 55.43       O6  O
ATOM  *****  O7  NDG H   1     131.816  50.998  39.647  0.50 49.91       O7  O
ATOM  *****  N2  NDG H   1     129.745  51.788  39.954  0.50 57.44       N2  N
ATOM  *****  C2  GAL H   3     125.660  45.968  39.508  0.50 55.84       C2  C
ATOM  *****  C3  GAL H   3     125.775  44.502  39.265  0.50 55.55       C3  C
ATOM  *****  C4  GAL H   3     126.979  44.230  38.393  0.50 54.74       C4  C
ATOM  *****  C5  GAL H   3     128.213  44.817  39.098  0.50 53.61       C5  C
ATOM  *****  C6  GAL H   3     129.527  44.621  38.390  0.50 52.93       C6  C
ATOM  *****  O2  GAL H   3     124.550  46.186  40.364  0.50 58.42       O2  O
ATOM  *****  O3  GAL H   3     124.566  44.069  38.653  0.50 62.45       O3  O
ATOM  *****  O4  GAL H   3     126.738  44.823  37.115  0.50 48.93       O4  O
ATOM  *****  O5  GAL H   3     128.030  46.229  39.235  0.50 57.53       O5  O
ATOM  *****  O6  GAL H   3     130.579  44.497  39.353  0.50 53.78       O6  O
ATOM  *****  C2  NDG I   1      99.055  57.680  22.648  1.00104.55       C2  C
ATOM  *****  C3  NDG I   1      99.149  56.253  23.206  1.00101.03       C3  C
ATOM  *****  C4  NDG I   1     100.515  55.661  22.875  1.00104.12       C4  C
ATOM  *****  C5  NDG I   1     101.573  56.553  23.521  1.00101.01       C5  C
ATOM  *****  C6  NDG I   1     102.993  56.069  23.333  1.00 94.08       C6  C
ATOM  *****  C7  NDG I   1      96.960  58.832  22.004  1.00 95.64       C7  C
ATOM  *****  C8  NDG I   1      96.135  60.035  22.362  1.00 86.44       C8  C
ATOM  *****  O5  NDG I   1     101.483  57.863  22.923  1.00 97.21       O5  O
ATOM  *****  O3  NDG I   1      98.121  55.360  22.741  1.00 80.91       O3  O
ATOM  *****  O4  NDG I   1     100.581  54.304  23.372  1.00113.61       O4  O
ATOM  *****  O6  NDG I   1     103.342  56.031  21.956  1.00 92.74       O6  O
ATOM  *****  O7  NDG I   1      96.861  58.293  20.905  1.00 92.25       O7  O
ATOM  *****  N2  NDG I   1      97.808  58.372  22.939  1.00102.41       N2  N
ATOM  *****  C2  GAL I   3     101.184  51.989  23.442  1.00106.05       C2  C
ATOM  *****  C3  GAL I   3     101.562  50.794  22.591  1.00102.03       C3  C
ATOM  *****  C4  GAL I   3     100.490  50.552  21.539  1.00102.45       C4  C
ATOM  *****  C5  GAL I   3     100.297  51.829  20.707  1.00103.81       C5  C
ATOM  *****  C6  GAL I   3      99.215  51.718  19.655  1.00 94.77       C6  C
ATOM  *****  O2  GAL I   3     102.195  52.231  24.417  1.00106.98       O2  O
ATOM  *****  O3  GAL I   3     101.742  49.652  23.426  1.00 98.93       O3  O
ATOM  *****  O4  GAL I   3      99.261  50.192  22.173  1.00101.72       O4  O
ATOM  *****  O5  GAL I   3      99.937  52.925  21.594  1.00109.46       O5  O
ATOM  *****  O6  GAL I   3      98.784  53.000  19.208  1.00 86.49       O6  O
ATOM  *****  C2  NDG J   1      97.879  31.964  35.262  1.00 88.75       C2  C
ATOM  *****  C3  NDG J   1      96.853  31.022  35.916  1.00 77.46       C3  C
ATOM  *****  C4  NDG J   1      97.131  30.768  37.397  1.00 79.03       C4  C
ATOM  *****  C5  NDG J   1      97.426  32.067  38.145  1.00 78.66       C5  C
ATOM  *****  C6  NDG J   1      97.754  31.845  39.609  1.00 75.61       C6  C
ATOM  *****  C7  NDG J   1      98.060  33.262  33.164  1.00 94.20       C7  C
ATOM  *****  C8  NDG J   1      97.306  34.220  32.290  1.00 85.11       C8  C
ATOM  *****  O5  NDG J   1      98.552  32.736  37.539  1.00 72.07       O5  O
ATOM  *****  O3  NDG J   1      96.731  29.746  35.230  1.00 64.87       O3  O
ATOM  *****  O4  NDG J   1      95.947  30.180  37.968  1.00 75.80       O4  O
ATOM  *****  O6  NDG J   1      98.858  30.945  39.788  1.00 83.70       O6  O
ATOM  *****  O7  NDG J   1      99.271  33.103  33.061  1.00108.58       O7  O
ATOM  *****  N2  NDG J   1      97.340  32.584  34.062  1.00 92.05       N2  N
ATOM  *****  C2  GAL J   3      94.598  28.542  39.052  1.00 76.19       C2  C
ATOM  *****  C3  GAL J   3      94.622  27.188  39.735  1.00 75.48       C3  C
ATOM  *****  C4  GAL J   3      95.328  26.134  38.877  1.00 84.99       C4  C
ATOM  *****  C5  GAL J   3      96.697  26.642  38.345  1.00 80.36       C5  C
ATOM  *****  C6  GAL J   3      97.347  25.752  37.287  1.00 74.52       C6  C
ATOM  *****  O2  GAL J   3      94.017  29.541  39.892  1.00 65.08       O2  O
ATOM  *****  O3  GAL J   3      93.266  26.809  39.990  1.00 80.31       O3  O
ATOM  *****  O4  GAL J   3      94.474  25.770  37.782  1.00 93.64       O4  O
ATOM  *****  O5  GAL J   3      96.515  27.938  37.723  1.00 78.82       O5  O
ATOM  *****  O6  GAL J   3      97.826  24.482  37.788  1.00 59.75       O6  O
ATOM  *****  C2  NDG K   1     114.122  30.158  40.381  1.00 77.82       C2  C
ATOM  *****  C3  NDG K   1     115.478  29.494  40.668  1.00 71.19       C3  C
ATOM  *****  C4  NDG K   1     116.632  30.105  39.877  1.00 72.65       C4  C
ATOM  *****  C5  NDG K   1     116.585  31.630  39.895  1.00 71.39       C5  C
ATOM  *****  C6  NDG K   1     117.673  32.254  39.041  1.00 64.02       C6  C
ATOM  *****  C7  NDG K   1     111.871  29.923  41.310  1.00 81.30       C7  C
ATOM  *****  C8  NDG K   1     111.044  30.338  42.489  1.00 73.24       C8  C
ATOM  *****  O5  NDG K   1     115.315  32.066  39.373  1.00 74.99       O5  O
ATOM  *****  O3  NDG K   1     115.425  28.070  40.402  1.00 55.13       O3  O
ATOM  *****  O4  NDG K   1     117.877  29.686  40.473  1.00 73.19       O4  O
ATOM  *****  O6  NDG K   1     117.627  31.750  37.704  1.00 70.83       O6  O
ATOM  *****  O7  NDG K   1     111.366  29.607  40.237  1.00 89.59       O7  O
ATOM  *****  N2  NDG K   1     113.194  29.932  41.474  1.00 80.44       N2  N
ATOM  *****  C2  GAL K   3     119.954  28.656  40.566  1.00 68.97       C2  C
ATOM  *****  C3  GAL K   3     121.037  27.896  39.831  1.00 73.39       C3  C
ATOM  *****  C4  GAL K   3     120.499  26.800  38.882  1.00 76.50       C4  C
ATOM  *****  C5  GAL K   3     119.209  27.220  38.117  1.00 90.25       C5  C
ATOM  *****  C6  GAL K   3     118.445  26.063  37.466  1.00 89.23       C6  C
ATOM  *****  O2  GAL K   3     120.487  29.831  41.162  1.00 67.17       O2  O
ATOM  *****  O3  GAL K   3     121.870  27.349  40.858  1.00 73.27       O3  O
ATOM  *****  O4  GAL K   3     120.214  25.611  39.614  1.00 77.78       O4  O
ATOM  *****  O5  GAL K   3     118.276  27.859  39.038  1.00 89.06       O5  O
ATOM  *****  O6  GAL K   3     119.017  25.595  36.229  1.00 74.06       O6  O
ATOM  *****  C2  NDG L   1     110.531  35.590  24.369  1.00 84.72       C2  C
ATOM  *****  C3  NDG L   1     110.544  35.707  22.838  1.00 74.10       C3  C
ATOM  *****  C4  NDG L   1     109.181  36.153  22.327  1.00 71.56       C4  C
ATOM  *****  C5  NDG L   1     108.829  37.481  22.989  1.00 79.32       C5  C
ATOM  *****  C6  NDG L   1     107.537  38.093  22.490  1.00 76.90       C6  C
ATOM  *****  C7  NDG L   1     112.199  34.726  25.958  1.00 95.38       C7  C
ATOM  *****  C8  NDG L   1     113.219  35.283  26.909  1.00 78.02       C8  C
ATOM  *****  O5  NDG L   1     108.676  37.251  24.403  1.00 82.22       O5  O
ATOM  *****  O3  NDG L   1     110.944  34.489  22.163  1.00 62.44       O3  O
ATOM  *****  O4  NDG L   1     109.222  36.312  20.895  1.00 67.00       O4  O
ATOM  *****  O6  NDG L   1     106.593  37.097  22.112  1.00 79.72       O6  O
ATOM  *****  O7  NDG L   1     111.699  33.614  26.107  1.00101.97       O7  O
ATOM  *****  N2  NDG L   1     111.871  35.503  24.921  1.00 93.53       N2  N
ATOM  *****  C2  GAL L   3     108.710  35.854  18.643  1.00 68.77       C2  C
ATOM  *****  C3  GAL L   3     107.868  35.045  17.663  1.00 77.04       C3  C
ATOM  *****  C4  GAL L   3     107.722  33.566  18.066  1.00 77.30       C4  C
ATOM  *****  C5  GAL L   3     107.478  33.376  19.596  1.00 80.65       C5  C
ATOM  *****  C6  GAL L   3     107.666  31.942  20.075  1.00 78.89       C6  C
ATOM  *****  O2  GAL L   3     108.583  37.245  18.377  1.00 62.47       O2  O
ATOM  *****  O3  GAL L   3     108.460  35.147  16.361  1.00 84.59       O3  O
ATOM  *****  O4  GAL L   3     108.879  32.830  17.659  1.00 66.83       O4  O
ATOM  *****  O5  GAL L   3     108.396  34.195  20.380  1.00 76.85       O5  O
ATOM  *****  O6  GAL L   3     106.705  31.022  19.510  1.00 78.11       O6  O
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
ERROR reading coordinate file. WHAT IF is trying to recover.
Please check your SOUP carefully after this option finished.
The line in the input file that created this problem is:
 
# 2 # Note: Header records from PDB file
Header records from PDB file.
 
HEADER                                                        1SL6
 
# 3 # Error: Missing unit cell information
No SCALE matrix is given in the PDB file.
 
# 4 # Note: Proposal for corrected SCALE matrix
A corrected SCALE matrix has been derived.
 
Proposed scale matrix
  0.006504  0.003755  0.000000
  0.000000  0.007510  0.000000
  0.000000  0.000000  0.007770
 
# 5 # Note: Non crystallographic symmetry RMS plot
The plot shows the RMS differences between two similar chains on a residue-
by-residue basis. Individual "spikes" can be indicative of interesting or
wrong residues. If all residues show a high RMS value, the structure could
be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: A and D
 
 All-atom RMS fit for the two chains : 4.748
 CA-only RMS fit for the two chains : 4.486
 
# 6 # Note: Non crystallographic symmetry backbone difference plot
The plot shows the differences in backbone torsion angles between two
similar chains on a residue-by-residue basis. Individual "spikes" can be
indicative of interesting or wrong residues. If all residues show high
differences, the structure could be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: A and D
 
# 7 # Note: Non crystallographic symmetry RMS plot
The plot shows the RMS differences between two similar chains on a residue-
by-residue basis. Individual "spikes" can be indicative of interesting or
wrong residues. If all residues show a high RMS value, the structure could
be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: A and B
 
 All-atom RMS fit for the two chains : 0.457
 CA-only RMS fit for the two chains : 0.276
 
# 8 # Note: Non crystallographic symmetry backbone difference plot
The plot shows the differences in backbone torsion angles between two
similar chains on a residue-by-residue basis. Individual "spikes" can be
indicative of interesting or wrong residues. If all residues show high
differences, the structure could be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: A and B
 
# 9 # Note: Non crystallographic symmetry RMS plot
The plot shows the RMS differences between two similar chains on a residue-
by-residue basis. Individual "spikes" can be indicative of interesting or
wrong residues. If all residues show a high RMS value, the structure could
be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: A and C
 
 All-atom RMS fit for the two chains : 0.451
 CA-only RMS fit for the two chains : 0.256
 
# 10 # Note: Non crystallographic symmetry backbone difference plot
The plot shows the differences in backbone torsion angles between two
similar chains on a residue-by-residue basis. Individual "spikes" can be
indicative of interesting or wrong residues. If all residues show high
differences, the structure could be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: A and C
 
# 11 # Note: Non crystallographic symmetry RMS plot
The plot shows the RMS differences between two similar chains on a residue-
by-residue basis. Individual "spikes" can be indicative of interesting or
wrong residues. If all residues show a high RMS value, the structure could
be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: A and E
 
 All-atom RMS fit for the two chains : 4.865
 CA-only RMS fit for the two chains : 4.574
 
# 12 # Note: Non crystallographic symmetry backbone difference plot
The plot shows the differences in backbone torsion angles between two
similar chains on a residue-by-residue basis. Individual "spikes" can be
indicative of interesting or wrong residues. If all residues show high
differences, the structure could be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: A and E
 
# 13 # Note: Non crystallographic symmetry RMS plot
The plot shows the RMS differences between two similar chains on a residue-
by-residue basis. Individual "spikes" can be indicative of interesting or
wrong residues. If all residues show a high RMS value, the structure could
be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: A and F
 
 All-atom RMS fit for the two chains : 4.743
 CA-only RMS fit for the two chains : 4.474
 
# 14 # Note: Non crystallographic symmetry backbone difference plot
The plot shows the differences in backbone torsion angles between two
similar chains on a residue-by-residue basis. Individual "spikes" can be
indicative of interesting or wrong residues. If all residues show high
differences, the structure could be incorrectly refined.
 
In the TeX file, a plot has been inserted here
 
Chain identifiers of the two chains: A and F
 
# 15 # Note: NCS statistics suppressed
There are more pairs of NCS equivalent molecules, but the statistics
will not be shown.
 
# 16 # Warning: Problem detected upon counting molecules and matrices
The parameter Z as given on the CRYST card represents the molecular
multiplicity in the crystallographic cell. Normally, Z equals the number of
matrices of the space group multiplied by the number of NCS relations. The
value of Z is multiplied by the integrated molecular weight of the molecules
in the file to determine the Matthews coefficient. This relation is being
validated in this option. Be aware that the validation can get confused if
both multiple copies of the molecule are present in the ATOM records and
MTRIX records are present in the header of the PDB file.
 
 Space group as read from CRYST card: P 32 2 1
 Number of matrices in space group: 6
 Highest polymer chain multiplicity in structure: 6
 Highest polymer chain multiplicity according to SEQRES: 4
 There is also strong SEQRES evidence for a multiplicity of: 6
 No explicit MTRIX NCS matrices found in the input file
 Value of Z as found on the CRYST1 card: 0
 Polymer chain multiplicity and SEQRES multiplicity disagree 6 4
 Z agrees neither with the 3D multiplicity, nor with the SEQRES multiplicity
 It could be that Z must be one of: 24 36
 
# 17 # Error: Matthews Coefficient (Vm) very high
 
The Matthews coefficient [REF] is defined as the density of the protein
structure in cubic Angstroms per Dalton. Normal values are between 1.5
(tightly packed, little room for solvent) and 4.0 (loosely packed, much
space for solvent). Some very loosely packed structures can get values a bit
higher than that.
 
Numbers this high are almost always caused by giving the wrong value for Z
on the CRYST1 card (or not giving this number at all).
 
 Molecular weight of all polymer chains: 118909.102
 Volume of the Unit Cell V= 2634790.8
 Space group multiplicity: 6
 No NCS symmetry matrices (MTRIX records) found in PDB file
 Matthews coefficient for observed atoms and Z is high: Vm= 88.632
 A few residues have missing atoms that did not enter the Vm calculation
 No Matthews coefficient given in REMARK 280
 SEQRES and ATOM multiplicities disagree. Error-reasoning thus is difficult.
 (and the absence of MTRIX records doesn't help)
 And remember, a matrix counting problem has been reported earlier already
 
# 18 # Note: Z missing on CRYST1 card
The messages above seem likely caused by the fact that Z is missing from the
CRYST1 card.
 
# 19 # Note: All atoms are sufficiently far away from symmetry axes
None of the atoms in the structure is closer than 0.77 Angstrom to a proper
symmetry axis.
 
# 20 # Note: Chain identifiers OK
WHAT CHECK has not detected any serious chain identifier problems. But be
aware that WHAT CHECK doesn't care about the chain identifiers of waters.
 
# 21 # Warning: Ligands for which a topology was generated automatically
The topology for the ligands in the table below were determined
automatically. WHAT CHECK uses a local copy of the CCP4 monomer library to
generate topology information for ligands. Be aware that automatic topology
generation is a complicated task. So, if you get messages that you fail to
understand or that you believe are wrong, and one of these ligands is
involved, then check the ligand topology entry first. This topology is either
present in the monomer library, or as a libcheck-generated file in the local
directory.
 
 1039 NDG  (   1-) G  -
 1040 GAL  (   3-) G  -
 1041 NDG  (   1-) H  -
 1042 GAL  (   3-) H  -
 1043 NDG  (   1-) I  -
 1044 GAL  (   3-) I  -
 1045 NDG  (   1-) J  -
 1046 GAL  (   3-) J  -
 1047 NDG  (   1-) K  -
 1048 GAL  (   3-) K  -
 1049 NDG  (   1-) L  -
 1050 GAL  (   3-) L  -
 
# 22 # Note: Covalently bound ligands
No problems were detected that seem related to covalently bound ligands.
 
# 23 # Note: No strange inter-chain connections detected
No covalent bonds have been detected between molecules with non-identical
chain identifiers.
 
# 24 # Note: No duplicate atom names in ligands
All atom names in ligands (if any) seem adequately unique.
 
# 25 # Note: In all cases the primary alternate atom was used
WHAT CHECK saw no need to make any alternate atom corrections (which means
they either are all correct, or there are none).
 
# 26 # Note: No residues detected inside ligands
Either this structure does not contain ligands with amino acid groups inside
it, or their naming is proper (enough).
 
# 27 # Note: No attached groups interfere with hydrogen bond calculations
It seems there are no sugars, lipids, etc., bound (or very close) to atoms
that otherwise could form hydrogen bonds.
 
# 28 # Note: No probable side chain atoms with zero occupancy detected.
Either there are no side chain atoms with zero occupancy, or the side chain
atoms with zero occupancy were not present in the input PDB file (in which
case they are listed as missing atoms), or their positions are sufficiently
improbable to warrant a zero occupancy.
 
# 29 # Note: No probable backbone atoms with zero occupancy detected.
Either there are no backbone atoms with zero occupancy, or the backbone
atoms with zero occupancy were left out of the input PDB file (in
which case they are listed as missing atoms), or their positions are
sufficiently improbable to warrant a zero occupancy.
 
# 30 # Note: All residues have a complete backbone.
No residues have missing backbone atoms.
 
# 31 # Note: No C-alpha only residues
There are no residues that consist of only an alpha carbon atom.
 
# 32 # Note: Content of the PDB file as interpreted by WHAT CHECK
Content of the PDB file as interpreted by WHAT CHECK.
WHAT CHECK has read your PDB file, and stored it internally in what is called
'the soup'. The content of this soup is listed here. An extensive explanation
of all frequently used WHAT CHECK output formats can be found at
swift.cmbi.ru.nl. Look under output formats. A course on reading this
'Molecules' table is part of the WHAT CHECK website.
 
     1     1 (  219)   168 (  397) A Protein             /zata/tempdir/1sl...
     2   169 (  219)   336 (  397) D Protein             /zata/tempdir/1sl...
     3   337 (  219)   504 (  397) B Protein             /zata/tempdir/1sl...
     4   505 (  219)   672 (  397) C Protein             /zata/tempdir/1sl...
     5   673 (  219)   840 (  397) E Protein             /zata/tempdir/1sl...
     6   841 (  219)  1008 (  397) F Protein             /zata/tempdir/1sl...
     7  1009 (    2)  1009 (    2) G Sugar               /zata/tempdir/1sl...
     8  1010 (    2)  1010 (    2) H Sugar               /zata/tempdir/1sl...
     9  1011 (    2)  1011 (    2) I Sugar               /zata/tempdir/1sl...
    10  1012 (    2)  1012 (    2) J Sugar               /zata/tempdir/1sl...
    11  1013 (    2)  1013 (    2) K Sugar               /zata/tempdir/1sl...
    12  1014 (    2)  1014 (    2) L Sugar               /zata/tempdir/1sl...
    13  1015 (    1)  1015 (    1) A  CA                 /zata/tempdir/1sl...
    14  1016 (    2)  1016 (    2) A  CA                 /zata/tempdir/1sl...
    15  1017 (    3)  1017 (    3) A  CA                 /zata/tempdir/1sl...
And so on for a total of    54 lines.
MODELs skipped upon reading PDB file: 0
X-ray structure. No MODELs found
The total number of amino acids found is 1008
of which 87 have poor or (essentially) missing atoms
No nucleic acids observed in input file
Number of (recognized) sugars: 6
Number of water molecules: 6
Residue numbers increase monotonously OK
 
# 33 # Warning: Ions bound to the wrong chain
The ions listed in the table have a chain identifier that is the same as one
of the protein, nucleic acid, or sugar chains. However, the ion seems bound
to protein, nucleic acid, or sugar, with another chain identifier.
 
Obviously, this is not wrong, but it is confusing for users of this PDB file.
 
 1034  CA  (   4-) E  -
 1038  CA  (   4-) F  -
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
 
# 34 # Note: Ramachandran plot
In this Ramachandran plot x-signs represent glycines, squares represent
prolines, and plus-signs represent the other residues. If too many
plus-signs fall outside the contoured areas then the molecule is poorly
refined (or worse). Proline can only occur in the narrow region around
phi=-60 that also falls within the other contour islands.
 
In a colour picture, the residues that are part of a helix are shown in blue,
strand residues in red. Preferred regions for helical residues are drawn in
blue, for strand residues in red, and for all other residues in green. A full
explanation of the Ramachandran plot together with a series of examples can
be found at the WHAT CHECK website [REF].
 
In the TeX file, a plot has been inserted here
 
Chain identifier: A
 
# 35 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: D
 
# 36 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: B
 
# 37 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: C
 
# 38 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: E
 
# 39 # Note: Ramachandran plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: F
 
# 40 # Note: Secondary structure
This is the secondary structure according to DSSP. Only helix (H), overwound
or 3/10-helix (3), strand (S), turn (T) and coil (blank) are shown [REF].
All DSSP related information can be found at swift.cmbi.ru.nl/gv/dssp/
This is not really a structure validation option, but a very scattered
secondary structure (i.e. many strands of only a few residues length, many
Ts inside helices, etc) tends to indicate a poor structure. A full
explanation of the DSSP secondary structure determination program together
with a series of examples can be found at the WHAT CHECK website [REF].
 
Secondary structure assignment
                     10        20        30        40        50        60
                      |         |         |         |         |         |
    1 -   60 PEKSKLQEIYQELTQLKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNW
( 219)-( 289)
                     70        80        90       100       110       120
                      |         |         |         |         |         |
   61 -  120 HDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSP
( 290)-( 349)
                    130       140       150       160
                      |         |         |         |
  121 -  168 SFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFR
( 350)-( 397)
            170       180       190       200       210       220
              |         |         |         |         |         |
  169 -  228 PEKSKLQEIYQELTQLKAAQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNW
( 219)-( 289)
            230       240       250       260       270       280
              |         |         |         |         |         |
  229 -  288 HDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSP
( 290)-( 349)
            290       300       310       320       330
              |         |         |         |         |
  289 -  336 SFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFR
( 350)-( 397)
              340       350       360       370       380       390
                |         |         |         |         |         |
  337 -  396 PEKSKLQEIYQELTQLKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNW
( 219)-( 289)
              400       410       420       430       440       450
                |         |         |         |         |         |
  397 -  456 HDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSP
( 290)-( 349)
              460       470       480       490       500
                |         |         |         |         |
  457 -  504 SFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFR
( 350)-( 397)
                510       520       530       540       550       560
                  |         |         |         |         |         |
  505 -  564 PEKSKLQEIYQELTQLKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNW
( 219)-( 289)
                570       580       590       600       610       620
                  |         |         |         |         |         |
  565 -  624 HDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSP
( 290)-( 349)
                630       640       650       660       670
                  |         |         |         |         |
  625 -  672 SFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFR
( 350)-( 397)
                  680       690       700       710       720       730
                    |         |         |         |         |         |
  673 -  732 PEKSKLQEIYQELTQLKAAQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNW
( 219)-( 289)
                  740       750       760       770       780       790
                    |         |         |         |         |         |
  733 -  792 HDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSP
( 290)-( 349)
                  800       810       820       830       840
                    |         |         |         |         |
  793 -  840 SFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFR
( 350)-( 397)
                    850       860       870       880       890       900
                      |         |         |         |         |         |
  841 -  900 PEKSKLQEIYQELTQLKAAQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNW
( 219)-( 289)
                    910       920       930       940       950       960
                      |         |         |         |         |         |
  901 -  960 HDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSP
( 290)-( 349)
                    970       980       990      1000
                      |         |         |         |
  961 - 1008 SFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFR
( 350)-( 397)
 
 
 
 
# 41 # Note: No rounded coordinates detected
No significant rounding of atom coordinates has been detected.
 
# 42 # Note: No artificial side chains detected
No artificial side-chain positions characterized by chi-1=0.0 or chi-1=180.0
have been detected.
 
# 43 # Warning: Missing atoms
The atoms listed in the table below are missing from the entry. If many atoms
are missing, the other checks can become less sensitive. Be aware that it
often happens that groups at the termini of DNA or RNA are really missing,
so that the absence of these atoms normally is neither an error nor the
result of poor electron density. Some of the atoms listed here might also be
listed by other checks, most noticeably by the options in the previous
section that list missing atoms in several categories. The plausible atoms
with zero occupancy are not listed here, as they already got assigned a
non-zero occupancy, and thus are no longer 'missing'.
 
   17 LYS  ( 246-) A  -    CG
   17 LYS  ( 246-) A  -    CD
   17 LYS  ( 246-) A  -    CE
   17 LYS  ( 246-) A  -    NZ
   19 GLN  ( 248-) A  -    CG
   19 GLN  ( 248-) A  -    CD
   19 GLN  ( 248-) A  -    OE1
   19 GLN  ( 248-) A  -    NE2
  168 ARG  ( 397-) A  -    CG
  168 ARG  ( 397-) A  -    CD
  168 ARG  ( 397-) A  -    NE
  168 ARG  ( 397-) A  -    CZ
  168 ARG  ( 397-) A  -    NH1
  168 ARG  ( 397-) A  -    NH2
  336 ARG  ( 397-) D  -    CG
And so on for a total of    48 lines.
 
# 44 # Warning: B-factors outside the range 0.0 - 100.0
In principle, B-factors can have a very wide range of values, but in
practice, B-factors should not be zero while B-factors above 100.0
are a good indicator that the location of that atom is meaningless. Be
aware that the cutoff at 100.0 is arbitrary. 'High' indicates that atoms
with a B-factor > 100.0 were observed; 'Zero' indicates that atoms with
a B-factor of zero were observed.
 
    8 GLU  ( 226-) A  -   High
   10 TYR  ( 228-) A  -   High
   12 GLU  ( 230-) A  -   High
   17 LYS  ( 246-) A  -   High
   18 GLN  ( 247-) A  -   High
   20 GLN  ( 249-) A  -   High
   22 TYR  ( 251-) A  -   High
   23 GLN  ( 252-) A  -   High
   41 LYS  ( 270-) A  -   High
   71 ARG  ( 300-) A  -   High
  170 GLU  ( 220-) D  -   High
  172 SER  ( 222-) D  -   High
  173 LYS  ( 223-) D  -   High
  185 LYS  ( 235-) D  -   High
  186 ALA  ( 236-) D  -   High
And so on for a total of    82 lines.
 
# 45 # Note: C-terminus capping
The residues listed in the table below are either C-terminal or pseudo
C-terminal (i.e. last residue before a missing residue).
In X-ray the coordinates must be located in density. Mobility or disorder
sometimes cause this density to be so poor that the positions of the atoms
cannot be determined. Crystallographers tend to leave out the atoms in such
cases. In many cases the N- or C-terminal residues are too disordered to see.
In case of the N-terminus, you can often see from the residue numbers if
there are missing residues; at the C-terminus this is impossible. Therefore,
often the position of the backbone nitrogen of the first residue missing
at the C-terminal end is calculated and added to indicate that there
are missing residues. As a single N causes validation trouble, we remove
these single-N-residues before doing the validation. If this happened,
the label -N is added to the pseudo C-terminus. Other labels can be +X
in case something weird is bound to the backbone C, or +OXT if a spurious
OXT atom is found. -OXT indicates that an expected OXT is missing. 'Swap'
means that the O' and O'' (O and OXT in PDB files) have been swapped in
terms of nomenclature. 'Bad' means that something bad happened that WHAT IF
does not understand. In such cases you might get three residue numbers in
square brackets; one of those might be what WHAT IF had expected to find,
but then it also might not). In case of chain breaks the number of missing
residues is listen in round brackets. OK means what it suggests...
 
Be aware that we cannot easily see the difference between these errors and
errors in the chain and residue numbering schemes. So do not blindly trust
the table below. If you get weird errors at, or near, the left-over
incomplete C-terminal residue, please check by hand if a missing Oxt or
a removed single N is the cause. Also, many peptidic ligands get the same
chain identifier as the larger protein they are bound to. In such cases there
are more than one C-termini and OXTs with the same ID. WHAT IF gives some
random warnings about these cases. So, don't take everything at face value,
but think for yourself.
 
   16 LEU  ( 234-) A  -        OK (11)
  168 ARG  ( 397-) A  -        OK
  187 ALA  ( 237-) D  -        OK (11)
  336 ARG  ( 397-) D  -        OK
  352 LEU  ( 234-) B  -        OK (11)
  504 ARG  ( 397-) B  -        OK
  520 LEU  ( 234-) C  -        OK (11)
  672 ARG  ( 397-) C  -        OK
  691 ALA  ( 237-) E  -        OK (11)
  840 ARG  ( 397-) E  -        OK
  859 ALA  ( 237-) F  -        OK (11)
 1008 ARG  ( 397-) F  -        OK
 
# 46 # Note: Weights administratively correct
All atomic occupancy factors ('weights') fall in the 0.0--1.0 range, which
makes them administratively correct.
 
# 47 # Note: Normal distribution of occupancy values
 
The distribution of the occupancy values in this file seems 'normal'.
 
Be aware that this evaluation is merely the result of comparing this file
with about 500 well-refined high-resolution files in the PDB. If this file
has much higher or much lower resolution than the PDB files used
in WHAT CHECK's training set, non-normal values might very well be perfectly
fine, or normal values might actually be not so normal. So, this check is
actually more an indicator and certainly not a check in which I have great
confidence.
 
# 48 # Warning: Occupancy atoms do not add up to 1.0.
In principle, the occupancy of all alternates of one atom should add up till
1.0. A valid exception is the missing atom (i.e. an atom not seen in the
electron density) that is allowed to have a 0.0 occupancy. Sometimes this
even happens when there are no alternate atoms given...
 
Atoms want to move. That is the direct result of the second law of
thermodynamics, in a somewhat weird way of thinking. Any way, many atoms
seem to have more than one position where they like to sit, and they jump
between them. The population difference between those sites (which is related
to their energy differences) is seen in the occupancy factors. As also for
atoms it is 'to be or not to be', these occupancies should add up to 1.0.
Obviously, it is possible that they add up to a number less than 1.0, in
cases where there are yet more, but undetected' rotamers/positions in play,
but also in those cases a warning is in place as the information shown
in the PDB file is less certain than it could have been. The residues
listed below contain atoms that have an occupancy greater than zero, but
their alternates do not add up to one. 'Strange' is added as a comment when
we believe that the structure shows no obvious reasons why this residue
should have a reduced occupancy.
 
WARNING. Presently WHAT CHECK only deals with a maximum of two alternate
positions. A small number of atoms in the PDB has three alternates. In
those cases the warning given here should obviously be neglected!
In a next release we will try to fix this.
 
 1010 FUC  (   2-) H  -   0.50
 
# 49 # Warning: What type of B-factor?
WHAT CHECK does not yet know well how to cope with B-factors in case TLS has
been used. It simply assumes that the B-factor listed on the ATOM and HETATM
cards are the total B-factors. When TLS refinement is used that assumption
sometimes is not correct. The header of the PDB file states that TLS groups
were used. So, if WHAT CHECK complains about your  B-factors, while you think
that they are OK, then check for TLS related B-factor problems first.
 
Number of TLS groups mentione in PDB file header: 0
 
Temperature not mentioned in PDB file. This most likely means
that the temperature record is absent.
Room temperature assumed
 
# 50 # Note: Number of buried atoms with low B-factor is OK
For protein structures determined at room temperature, no more than about 1
percent of the B factors of buried atoms is below 5.0. In liquid
nitrogen this percentage is allowed to be higher, of course.
 
Percentage of buried atoms with B less than 5 :   0.00
 
# 51 # Note: B-factor distribution normal
The distribution of B-factors within residues is within expected ranges.
A value over 1.5 here would mean that the B-factors show signs of
over-refinement.
 
RMS Z-score :  0.923 over    7122 bonds
Average difference in B over a bond :    3.32
RMS difference in B over a bond :    4.65
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
 
# 52 # Note: B-factor plot
The average atomic B-factor per residue is plotted as function of the residue
number.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: A
 
# 53 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: D
 
# 54 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: B
 
# 55 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: C
 
# 56 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: E
 
# 57 # Note: B-factor plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: F
 
# 58 # Note: Introduction to the nomenclature section.
Nomenclature problems seem, at first, rather unimportant. After all who
cares if we call the delta atoms in leucine delta2 and delta1 rather than
the other way around. Chemically speaking that is correct. But structures
have not been solved and deposited just for chemists to look at them. Most
times a structure is used, it is by software in a bioinformatics lab. And
if they compare structures in which the one used C delta1 and delta2 and the
other uses C delta2 and delta1, then that comparison will fail. Also, we
recalculate all structures every so many years to make sure that everybody
always can get access to the best coordinates that can be obtained from
the (your?) experimental data. These recalculations will be troublesome if
there are nomenclature problems.
 
Several nomenclature problems actually are worse than that. At the
WHAT CHECK website [REF] you can get an overview of the importance of all
nomenclature problems that we list.
 
# 59 # Note: Valine nomenclature OK
No errors were detected in valine nomenclature.
 
# 60 # Note: Threonine nomenclature OK
No errors were detected in threonine nomenclature.
 
# 61 # Note: Isoleucine nomenclature OK
No errors were detected in isoleucine nomenclature.
 
# 62 # Note: Leucine nomenclature OK
No errors were detected in leucine nomenclature.
 
# 63 # Note: Arginine nomenclature OK
No errors were detected in arginine nomenclature.
 
# 64 # Warning: Tyrosine convention problem
The tyrosine residues listed in the table below have their chi-2 not between
-90.0 and 90.0
 
  157 TYR  ( 386-) A  -
  661 TYR  ( 386-) C  -
 
# 65 # Warning: Phenylalanine convention problem
The phenylalanine residues listed in the table below have their chi-2 not
between -90.0 and 90.0.
 
  290 PHE  ( 351-) D  -
  310 PHE  ( 371-) D  -
  794 PHE  ( 351-) E  -
  962 PHE  ( 351-) F  -
  982 PHE  ( 371-) F  -
 
# 66 # Note: Aspartic acid torsion conventions OK
No errors were detected in aspartic acid torsion angle conventions.
 
# 67 # Note: Glutamic acid torsion conventions OK
No errors were detected in glutamic acid torsion angle conventions.
 
# 68 # Note: Phosphate group names OK in DNA/RNA
No errors were detected in nucleic acid phosphate group naming conventions
(or this structure contains no nucleic acids).
 
# 69 # Note: Heavy atom naming OK
No errors were detected in the atom names for non-hydrogen atoms. Please
be aware that the PDB wants us to deliberately make some nomenclature errors;
especially in non-canonical amino acids.
 
# 70 # Note: No decreasing residue numbers
All residue numbers are strictly increasing within each chain.
 
# 71 # Warning: Unusual bond lengths
The bond lengths listed in the table below were found to deviate more than 4
sigma from standard bond lengths (both standard values and sigmas for amino
acid residues have been taken from Engh and Huber [REF], for DNA they were
taken from Parkinson et al [REF]). In the table below for each unusual bond
the bond length and the number of standard deviations it differs from the
normal value is given.
 
Atom names starting with "-" belong to the previous residue in the chain. If
the second atom name is "-SG*", the disulphide bridge has a deviating length.
 
  221 MET  ( 282-) D  -    SD   CE    1.55   -4.1
  893 MET  ( 282-) F  -    SD   CE    1.42   -6.3
  235 CYS  ( 296-) D  -    SG  -SG*   2.22    4.5
  328 CYS  ( 389-) D  -    SG  -SG*   2.22    4.5
  403 CYS  ( 296-) B  -    SG  -SG*   2.23    4.8
  496 CYS  ( 389-) B  -    SG  -SG*   2.23    4.8
  739 CYS  ( 296-) E  -    SG  -SG*   2.20    4.0
  832 CYS  ( 389-) E  -    SG  -SG*   2.20    4.0
  907 CYS  ( 296-) F  -    SG  -SG*   2.20    4.0
 1000 CYS  ( 389-) F  -    SG  -SG*   2.20    4.0
 
# 72 # Warning: Low bond length variability
Bond lengths were found to deviate less than normal from the mean Engh and
Huber [REF] and/or Parkinson et al [REF] standard bond lengths. The RMS
Z-score given below is expected to be near 1.0 for a normally restrained
data set. The fact that it is lower than 0.667 in this structure might
indicate that too-strong restraints have been used in the refinement. This
can only be a problem  for high resolution X-ray structures.
 
 RMS Z-score for bond lengths: 0.571
 RMS-deviation in bond distances: 0.016
 
# 73 # Warning: Possible cell scaling problem
Comparison of bond distances with Engh and Huber [REF] standard values for
protein residues and Parkinson et al [REF] values for DNA/RNA shows a
significant systematic deviation. It could be that the unit cell used in
refinement was not accurate enough. The deformation matrix given below gives
the deviations found: the three numbers on the diagonal represent the
relative corrections needed along the A, B and C cell axis. These values are
1.000 in a normal case, but have significant deviations here (significant at
the 99.99 percent confidence level)
 
There are a number of different possible causes for the discrepancy. First
the cell used in refinement can be different from the best cell calculated.
Second, the value of the wavelength used for a synchrotron data set can be
miscalibrated. Finally, the discrepancy can be caused by a dataset that has
not been corrected for significant anisotropic thermal motion.
 
Please note that the proposed scale matrix has NOT been restrained to obey
the space group symmetry. This is done on purpose. The distortions can give
you an indication of the accuracy of the determination.
 
If you intend to use the result of this check to change the cell dimension
of your crystal, please read the extensive literature on this topic first.
This check depends on the wavelength, the cell dimensions, and on the
standard bond lengths and bond angles used by your refinement software.
 
SCALE matrix obtained from PDB file
  0.006504  0.003755  0.000000
  0.000000  0.007510  0.000000
  0.000000  0.000000  0.007770
Unit Cell deformation matrix
  1.001824 -0.000002 -0.000032
 -0.000002  1.001298 -0.000003
 -0.000032 -0.000003  1.000495
Proposed new scale matrix
  0.006492  0.003750  0.000000
  0.000000  0.007501  0.000000
  0.000000  0.000000  0.007766
With corresponding cell
    A    = 154.031  B   = 153.971  C    = 128.766
    Alpha=  90.000  Beta=  90.000  Gamma= 120.000
 
The CRYST1 cell dimensions
    A    = 153.750  B   = 153.750  C    = 128.702
    Alpha=  90.000  Beta=  90.000  Gamma= 120.000
 
 Variance: 55.661
 (Under-)estimated Z-score: 5.498
 
# 74 # Warning: Unusual bond angles
The bond angles listed in the table below were found to deviate more than 4
sigma from standard bond angles (both standard values and sigma for protein
residues have been taken from Engh and Huber [REF], for DNA/RNA from
Parkinson et al [REF]). In the table below for each strange angle the bond
angle and the number of standard deviations it differs from the standard
values is given. Please note that disulphide bridges are neglected. Atoms
starting with "-" belong to the previous residue in the sequence.
 
   27 ASP  ( 256-) A  -    CA   CB   CG  117.76    5.2
   84 ASN  ( 313-) A  -    CB   CG   ND2 122.72    4.2
   84 ASN  ( 313-) A  -    ND2  CG   OD1 118.38   -4.2
  124 ARG  ( 353-) A  -    CB   CG   CD  105.77   -4.2
  124 ARG  ( 353-) A  -    CG   CD   NE  118.16    4.5
  153 ASP  ( 382-) A  -    CA   CB   CG  116.91    4.3
  195 ASP  ( 256-) D  -    CA   CB   CG  118.74    6.1
  321 ASP  ( 382-) D  -    CA   CB   CG  116.97    4.4
  363 ASP  ( 256-) B  -    CA   CB   CG  118.54    5.9
  394 ARG  ( 287-) B  -    CB   CG   CD  104.96   -4.6
  485 ASP  ( 378-) B  -    CA   CB   CG  117.44    4.8
  489 ASP  ( 382-) B  -    CA   CB   CG  116.73    4.1
  531 ASP  ( 256-) C  -    CA   CB   CG  117.11    4.5
  588 ASN  ( 313-) C  -    ND2  CG   OD1 118.26   -4.3
  657 ASP  ( 382-) C  -    CA   CB   CG  116.83    4.2
  699 ASP  ( 256-) E  -    CA   CB   CG  118.43    5.8
  766 ASN  ( 323-) E  -    CA   CB   CG  104.90   -7.7
  767 ARG  ( 324-) E  -    CB   CG   CD  103.28   -5.4
  775 ASP  ( 332-) E  -    CA   CB   CG  116.62    4.0
  825 ASP  ( 382-) E  -    CA   CB   CG  116.86    4.3
  867 ASP  ( 256-) F  -    CA   CB   CG  118.36    5.8
  935 ARG  ( 324-) F  -    CB   CG   CD  104.41   -4.8
  993 ASP  ( 382-) F  -    CA   CB   CG  116.63    4.0
 
# 75 # Note: Normal bond angle variability
Bond angles were found to deviate normally from the mean standard bond angles
(normal values for protein residues were taken from Engh and Huber [REF], for
DNA/RNA from Parkinson et al [REF]). The RMS Z-score given below is expected
to be near 1.0 for a normally restrained data set, and this is indeed
observed for very high resolution X-ray structures.
 
 RMS Z-score for bond angles: 0.763
 RMS-deviation in bond angles: 1.388
 
# 76 # Note: Residue hand check OK
No atoms are observed that have the wrong handedness. Be aware, though, that
WHAT CHECK might have corrected the handedness of some atoms already. The
handedness has not been corrected for any case where the problem is worse
than just an administrative discomfort.
 
# 77 # Note: Chirality OK
All protein atoms have proper chirality, or there is no intact protein
present in the PDB file.
The average deviation= 0.891
 
# 78 # Note: Improper dihedral angle distribution OK
The RMS Z-score for all improper dihedrals in the structure is within normal
ranges.
 
 Improper dihedral RMS Z-score : 0.763
 
# 79 # Note: Tau angles OK
All of the tau angles (N-C-alpha-C) of amino acids fall within expected
RMS deviations.
 
# 80 # Note: Normal tau angle deviations
The RMS Z-score for the tau angles (N-C-alpha-C) in the structure falls
within the normal range that we guess to be 0.5 - 1.5. Be aware, we
determined the tau normal distributions from 500 high-resolution X-ray
structures, rather than from CSD data, so we cannot be 100 percent certain
about these numbers.
 
 Tau angle RMS Z-score : 0.787
 
# 81 # Error: Side chain planarity problems
The side chains of the residues listed in the table below contain a planar
group that was found to deviate from planarity by more than 4.0 times the
expected value. For an amino acid residue that has a side chain with a
planar group, the RMS deviation of the atoms to a least squares plane was
determined. The number in the table is the number of standard deviations
this RMS value deviates from the expected value. Not knowing better yet, we
assume that planarity of the groups analyzed should be perfect.
 
  976 ASN  ( 365-) F  -   5.86
  808 ASN  ( 365-) E  -   5.62
  719 GLN  ( 276-) E  -   5.57
  640 ASN  ( 365-) C  -   4.95
  136 ASN  ( 365-) A  -   4.52
  472 ASN  ( 365-) B  -   4.04
 
# 82 # Note: Atoms connected to aromatic rings OK
All of the atoms that are connected to planar aromatic rings in side chains
of amino-acid residues are in the plane within expected RMS deviations.
Since there is no DNA and no protein with hydrogens, no uncalibrated
planarity check was performed.
 
# 83 # Note: Ramachandran Z-score OK
The score expressing how well the backbone conformations of all residues
correspond to the known allowed areas in the Ramachandran plot is within
expected ranges for well-refined structures.
 
 Ramachandran Z-score : -1.866
 
# 84 # Note: Ramachandran check
The list contains per-residue Z-scores describing how well each residue
fits into the allowed areas of the Ramachandran plot will not be printed
because WHAT CHECK found no reason to cry.
 
# 85 # Warning: Torsion angle evaluation shows unusual residues
The residues listed in the table below contain bad or abnormal
torsion angles.
 
These scores give an impression of how `normal' the torsion angles in
protein residues are. All torsion angles except omega are used for
calculating a `normality' score. Average values and standard deviations were
obtained from the residues in the WHAT CHECK database. These are used to
calculate Z-scores. A residue with a Z-score of below -2.0 is poor, and a
score of less than -3.0 is worrying. For such residues more than one torsion
angle is in a highly unlikely position.
 
  709 ARG  ( 266-) E  -   -2.6
  373 ARG  ( 266-) B  -   -2.5
  877 ARG  ( 266-) F  -   -2.5
   37 ARG  ( 266-) A  -   -2.5
  541 ARG  ( 266-) C  -   -2.5
  205 ARG  ( 266-) D  -   -2.4
  557 MET  ( 282-) C  -   -2.1
  389 MET  ( 282-) B  -   -2.1
  746 LEU  ( 303-) E  -   -2.0
  578 LEU  ( 303-) C  -   -2.0
 
# 86 # Warning: Backbone evaluation reveals unusual conformations
The residues listed in the table below have abnormal backbone torsion
angles.
 
Residues with `forbidden' phi-psi combinations are listed, as well as
residues with unusual omega angles (deviating by more than 3 sigma from the
normal value). Please note that it is normal if about 5 percent of the
residues is listed here as having unusual phi-psi combinations.
 
   39 CYS  ( 268-) A  - Omega to (next) Pro poor
   42 ASP  ( 271-) A  - Poor phi/psi
   48 GLY  ( 277-) A  - Poor phi/psi
   71 ARG  ( 300-) A  - Poor phi/psi
   74 LEU  ( 303-) A  - omega poor
   98 TRP  ( 327-) A  - omega poor
  100 GLY  ( 329-) A  - Poor phi/psi
  102 SER  ( 331-) A  - omega poor
  108 GLY  ( 337-) A  - Poor phi/psi
  115 GLY  ( 344-) A  - Poor phi/psi
  116 SER  ( 345-) A  - Omega to (next) Pro poor
  119 SER  ( 348-) A  - Omega to (next) Pro poor
  129 GLY  ( 358-) A  - Poor phi/psi
  130 GLU  ( 359-) A  - Omega to (next) Pro poor
  135 GLY  ( 364-) A  - Poor phi/psi
And so on for a total of   123 lines.
 
# 87 # Error: Chi-1/chi-2 rotamer problems
List of residues with a poor chi-1/chi-2 combination. Be aware that for this
validation option the individual scores are far less important than the
overall score that is given below the table.
 
   16 LEU  ( 234-) A  -    -1.32
   74 LEU  ( 303-) A  -    -1.32
   88 LEU  ( 317-) A  -    -1.32
  184 LEU  ( 234-) D  -    -1.32
  242 LEU  ( 303-) D  -    -1.32
  352 LEU  ( 234-) B  -    -1.31
  410 LEU  ( 303-) B  -    -1.32
  424 LEU  ( 317-) B  -    -1.32
  520 LEU  ( 234-) C  -    -1.30
  578 LEU  ( 303-) C  -    -1.32
  592 LEU  ( 317-) C  -    -1.32
  688 LEU  ( 234-) E  -    -1.32
  746 LEU  ( 303-) E  -    -1.32
  760 LEU  ( 317-) E  -    -1.32
  856 LEU  ( 234-) F  -    -1.32
And so on for a total of   388 lines.
 
# 88 # Note: chi-1/chi-2 angle correlation Z-score OK
The score expressing how well the chi-1/chi-2 angles of all residues
correspond to the populated areas in the database is
within expected ranges for well-refined structures.
 
 chi-1/chi-2 correlation Z-score : -1.843
 
# 89 # Warning: Unusual rotamers
The residues listed in the table below have a rotamer that is not seen very
often in the database of solved protein structures. This option determines
for every residue the position specific chi-1 rotamer distribution.
Thereafter it verified whether the actual residue in the molecule has the
most preferred rotamer or not. If the actual rotamer is the preferred one,
the score is 1.0. If the actual rotamer is unique, the score is 0.0. If
there are two preferred rotamers, with a population distribution of 3:2 and
your rotamer sits in the lesser populated rotamer, the score will be 0.667.
No value will be given if insufficient hits are found in the database.
 
It is not necessarily an error if a few residues have rotamer values below
0.3, but careful inspection of all residues with these low values could be
worth it.
 
  274 GLN  ( 335-) D  -   0.36
  601 SER  ( 326-) C  -   0.38
   97 SER  ( 326-) A  -   0.38
  162 LYS  ( 391-) A  -   0.39
 
# 90 # Warning: Unusual backbone conformations
For the residues listed in the table below, the backbone formed by itself and
two neighbouring residues on either side is in a conformation that is not
seen very often in the database of solved protein structures. The number
given in the table is the number of similar backbone conformations in the
database with the same amino acid in the centre.
 
For this check, backbone conformations are compared with database structures
using C-alpha superpositions with some restraints on the backbone oxygen
positions.
 
A residue mentioned in the table can be part of a strange loop, or there
might be something wrong with it or its directly surrounding residues. There
are a few of these in every protein, but in any case it is worth looking at,
especially if a regular DSSP secondary structure (H or S for helix or strand,
respectively) is indicated!
 
   75 VAL  ( 304-) A  -       0
  243 VAL  ( 304-) D  -       0
  411 VAL  ( 304-) B  -       0
  579 VAL  ( 304-) C  -       0
  708 CYS  ( 265-) E  -       0
  747 VAL  ( 304-) E  -       0
  915 VAL  ( 304-) F  -       0
   37 ARG  ( 266-) A  -       1
  130 GLU  ( 359-) A  -       1
  132 ASN  ( 361-) A  -       1
  204 CYS  ( 265-) D  -       1
  298 GLU  ( 359-) D  -       1
  300 ASN  ( 361-) D  -       1
  466 GLU  ( 359-) B  -       1
  468 ASN  ( 361-) B  -       1
  634 GLU  ( 359-) C  -       1
  636 ASN  ( 361-) C  -       1
  802 GLU  ( 359-) E  -       1
  804 ASN  ( 361-) E  -       1
  876 CYS  ( 265-) F  -       1
  970 GLU  ( 359-) F  -       1
  972 ASN  ( 361-) F  -       1
  173 LYS  ( 223-) D  -       2
  541 ARG  ( 266-) C  -       2
  677 LYS  ( 223-) E  -       2
  845 LYS  ( 223-) F  -       2
 
# 91 # Note: Backbone conformation Z-score OK
The backbone conformation analysis gives a score that is normal for well
refined protein structures.
 
 Backbone conformation Z-score : -0.664
 
# 92 # Note: Omega angle restraint OK
The omega angles for trans-peptide bonds in a structure is expected to give a
gaussian distribution with the average around +178 degrees, and a standard
deviation around 5.5. In the current structure the standard deviation agrees
with this expectation.
 
Omega average and std. deviation= 178.710 5.791
 
# 93 # Warning: Unusual PRO puckering amplitudes
The proline residues listed in the table below have a puckering amplitude
that is outside of normal ranges. Puckering parameters were calculated by
the method of Cremer and Pople [REF]. Normal PRO rings have a puckering
amplitude Q between 0.20 and 0.45 Angstrom. If Q is lower than 0.20 Angstrom
for a PRO residue, this could indicate disorder between the two different
normal ring forms (with C-gamma below and above the ring, respectively). If
Q is higher than 0.45 Angstrom something could have gone wrong during the
refinement. Be aware that this is a warning with a low confidence level. See:
Who checks the checkers? Four validation tools applied to eight atomic
resolution structures [REF]
 
  299 PRO  ( 360-) D  -   0.20 LOW
  803 PRO  ( 360-) E  -   0.15 LOW
  971 PRO  ( 360-) F  -   0.18 LOW
 
# 94 # Warning: Unusual PRO puckering phases
The proline residues listed in the table below have a puckering phase that is
not expected to occur in protein structures. Puckering parameters were
calculated by the method of Cremer and Pople [REF]. Normal PRO rings
approximately show a so-called envelope conformation with the C-gamma atom
above the plane of the ring (phi=+72 degrees), or a half-chair conformation
with C-gamma below and C-beta above the plane of the ring (phi=-90 degrees).
If phi deviates strongly from these values, this is indicative of a very
strange conformation for a PRO residue, and definitely requires a manual
check of the data. Be aware that this is a warning with a low confidence
level. See: Who checks the checkers? Four validation tools applied to eight
atomic resolution structures [REF].
 
    1 PRO  ( 219-) A  -   49.7 half-chair C-delta/C-gamma (54 degrees)
  169 PRO  ( 219-) D  -   45.6 half-chair C-delta/C-gamma (54 degrees)
  337 PRO  ( 219-) B  -   46.9 half-chair C-delta/C-gamma (54 degrees)
  673 PRO  ( 219-) E  -   47.7 half-chair C-delta/C-gamma (54 degrees)
  841 PRO  ( 219-) F  -   48.4 half-chair C-delta/C-gamma (54 degrees)
 
# 95 # Note: Backbone oxygen evaluation OK
All residues for which similar local backbone conformations could be found
in the WHAT CHECK database have a backbone oxygen position that has been
observed at least a few times in that database.
 
# 96 # Warning: Possible peptide flips
For the residues listed in the table below, the backbone formed by the
residue mentioned and the one N-terminal of it show systematic deviations
from normality that are consistent with a peptide flip. This can either
be a 180 degree flip of the entire peptide plane or a trans to cis flip.
(Cis to trans flips cannot be detected yet). The type can be TT+, TC-,
or TC+:
TT+ indicates a 180 degree flip of the entire peptide plane.
TC- indicates a trans to cis conversion that requires a flip of the N atom.
TC+ indicates a trans to cis conversion that requires a flip of the O atom.
Note that the method will only work correctly for PDB files with full
isotropic B-factors.
 
  882 ASP  ( 271-) F  - TT+   Highly likely
   42 ASP  ( 271-) A  - TT+   Likely
  136 ASN  ( 365-) A  - TT+   Likely
  204 CYS  ( 265-) D  - TT+   Likely
  210 ASP  ( 271-) D  - TT+   Likely
  472 ASN  ( 365-) B  - TT+   Likely
  546 ASP  ( 271-) C  - TT+   Likely
  640 ASN  ( 365-) C  - TT+   Likely
  708 CYS  ( 265-) E  - TT+   Likely
  714 ASP  ( 271-) E  - TT+   Likely
  876 CYS  ( 265-) F  - TT+   Likely
 
# 97 # Error: Abnormally short interatomic distances
The pairs of atoms listed in the table below have an unusually short
interactomic distance; each bump is listed in only one direction.
 
The contact distances of all atom pairs have been checked. Two atoms are
said to `bump' if they are closer than the sum of their Van der Waals radii
minus 0.40 Angstrom. For hydrogen bonded pairs a tolerance of 0.55 Angstrom
is used. The first number in the table tells you how much shorter that
specific contact is than the acceptable limit. The second distance is the
distance between the centres of the two atoms. Although we believe that two
water atoms at 2.4 A distance are too close, we only report water pairs that
are closer than this rather short distance.
 
INTRA and INTER indicate whether the clashes are between atoms in the same
asymmetric unit, or atoms in symmetry related asymmetric units, respectively.
The last text-item on each line represents the status of the atom pair. If
the final column contains the text 'HB', the bump criterion was relaxed
because there could be a hydrogen bond. Similarly relaxed criteria are used
for 1--3 and 1--4 interactions (listed as 'B2' and 'B3', respectively).
If the last column is 'BF', the sum of the B-factors of the atoms is higher
than 80, which makes the appearance of the bump somewhat less severe because
the atoms probably are not there anyway. BL, on the other hand, indicates
that the bumping atoms both have a low B-factor, and that makes the bumps
more worrisome.
 
Bumps between atoms for which the sum of their occupancies is lower than one
are not reported. If the MODEL number does not exist (as is the case in most
X-ray files), a minus sign is printed instead.
 
  559 ASN  ( 284-) C  -    ND2 <-->   932 ARG  ( 321-) F  -    O      0.36    2.34  INTRA BF
  198 THR  ( 259-) D  -    CG2 <-->   202 ARG  ( 263-) D  -    NH2    0.23    2.87  INTRA BF
  202 ARG  ( 263-) D  -    O   <-->   205 ARG  ( 266-) D  -    CD     0.21    2.59  INTRA BF
  342 LEU  ( 224-) B  -    CD1 <-->   368 PHE  ( 261-) B  -    CZ     0.17    3.03  INTRA BF
    6 LEU  ( 224-) A  -    CD1 <-->    32 PHE  ( 261-) A  -    CZ     0.16    3.04  INTRA BF
   95 ARG  ( 324-) A  -    NH1 <-->   262 ASN  ( 323-) D  -    ND2    0.15    2.70  INTRA BF
  359 GLN  ( 252-) B  -    CD  <-->   964 ARG  ( 353-) F  -    NH2    0.15    2.95  INTRA BF
  510 LEU  ( 224-) C  -    CD1 <-->   536 PHE  ( 261-) C  -    CE2    0.14    3.06  INTRA BF
  510 LEU  ( 224-) C  -    CD1 <-->   536 PHE  ( 261-) C  -    CZ     0.13    3.07  INTRA BF
   55 ASN  ( 284-) A  -    ND2 <-->   260 ARG  ( 321-) D  -    O      0.13    2.57  INTRA BF
  599 ARG  ( 324-) C  -    NH1 <-->   934 ASN  ( 323-) F  -    ND2    0.12    2.73  INTRA BF
  504 ARG  ( 397-) B  -    NH1 <-->   714 ASP  ( 271-) E  -    CG     0.11    2.99  INTRA BF
  643 CYS  ( 368-) C  -    SG  <-->   656 CYS  ( 381-) C  -    CB     0.10    3.30  INTRA BF
  124 ARG  ( 353-) A  -    NH2 <-->   800 SER  ( 357-) E  -    OG     0.10    2.60  INTRA BF
  845 LYS  ( 223-) F  -    CB  <-->   846 LEU  ( 224-) F  -    N      0.09    2.61  INTRA BF
And so on for a total of    40 lines.
 
# 98 # Note: Some notes regarding these bumps
The bumps have been binned in 5 categories ranging from 'please look at'
till 'must fix'. Additionally, the integrated sum of all bumps, the squared
sum of all bumps, and these latter two values normalized by the number of
contacts are listed too for comparison purposes between, for example, small
and large proteins.
 
Total bump value: 3.590
Total bump value per residue: 0.039
Total number of bumps: 40
Total squared bump value: 0.511
Total number of bumps in the mildest bin: 39
Total number of bumps in the second bin: 1
Total number of bumps in the middle bin: 0
Total number of bumps in the fourth bin: 0
Total number of bumps in the worst bin: 0
 
# 99 # Note: Inside/outside distribution check
The following list contains per-residue Z-scores describing how well the
residue's observed accessibility fits the expected one. A positive Z-score
indicates "more exposure than usual", whereas a negative Z-score means
"more buried than usual". The absolute value of the Z-score must be used to
judge the quality. Today WHAT CHECK saw no reason to complain.
 
# 100 # Note: Inside/Outside residue distribution normal
The distribution of residue types over the inside and the outside of the
protein is normal.
 
inside/outside RMS Z-score : 1.094
 
# 101 # Note: Inside/Outside RMS Z-score plot
The Inside/Outside distribution normality RMS Z-score over a 15 residue
window is plotted as function of the residue number. High areas in the plot
(above 1.5) indicate unusual inside/outside patterns.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: A
 
# 102 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: D
 
# 103 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: B
 
# 104 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: C
 
# 105 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: E
 
# 106 # Note: Inside/Outside RMS Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: F
 
# 107 # Warning: Abnormal packing environment for some residues
The residues listed in the table below have an unusual packing environment.
 
The packing environment of the residues is compared with the average packing
environment for all residues of the same type in good PDB files. A low
packing score can indicate one of several things: Poor packing, misthreading
of the sequence through the density, crystal contacts, contacts with a
co-factor, or the residue is part of the active site. It is not uncommon to
see a few of these, but in any case this requires further inspection of the
residue.
 
  335 PHE  ( 396-) D  -  -7.61
  839 PHE  ( 396-) E  -  -7.54
 1007 PHE  ( 396-) F  -  -7.54
  167 PHE  ( 396-) A  -  -5.91
  575 ARG  ( 300-) C  -  -5.69
  743 ARG  ( 300-) E  -  -5.51
   71 ARG  ( 300-) A  -  -5.50
  503 PHE  ( 396-) B  -  -5.47
  239 ARG  ( 300-) D  -  -5.46
  911 ARG  ( 300-) F  -  -5.38
  351 GLN  ( 233-) B  -  -5.35
  610 GLN  ( 335-) C  -  -5.35
   15 GLN  ( 233-) A  -  -5.33
  519 GLN  ( 233-) C  -  -5.32
  442 GLN  ( 335-) B  -  -5.31
  106 GLN  ( 335-) A  -  -5.30
  671 PHE  ( 396-) C  -  -5.28
  407 ARG  ( 300-) B  -  -5.27
 
# 108 # Note: No series of residues with bad packing environment
There are no stretches of three or more residues each having a packing score
worse than -4.0.
 
# 109 # Note: Structural average packing environment OK
The structural average packing score is within normal ranges.
 
 
Average for range     1 - 1014 :  -0.262
 
# 110 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: A
 
# 111 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: D
 
# 112 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: B
 
# 113 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: C
 
# 114 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: E
 
# 115 # Note: Quality value plot
The quality value smoothed over a 10 residue window is plotted as function
of the residue number. Low areas in the plot (below -2.0) indicate unusual
packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: F
 
# 116 # Note: Second generation packing environment OK
None of the individual amino acid residues has a bad packing environment.
 
# 117 # Note: No series of residues with abnormal new packing environment
There are no stretches of four or more residues each having a packing
Z-score worse than -1.75.
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
ERROR. File not found:
TAPEOUT.DAT
 
# 118 # Note: Second generation quality Z-score plot
The second generation quality Z-score smoothed over a 10 residue window
is plotted as function of the residue number. Low areas in the plot (below
-1.3) indicate unusual packing.
 
In the TeX file, a plot has been inserted here
 
Chain identifier: A
 
# 119 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: D
 
# 120 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: B
 
# 121 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: C
 
# 122 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: E
 
# 123 # Note: Second generation quality Z-score plot
 
 
In the TeX file, a plot has been inserted here
 
Chain identifier: F
 
# 124 # Warning: No crystallisation information
No, or very inadequate, crystallisation information was observed upon
reading the PDB file header records. This information should be available
in the form of a series of REMARK 280 lines. Without this information a
few things, such as checking ions in the structure, cannot be performed
optimally.
 
# 125 # Note: Water contacts OK
All water clusters make at least one contact with a non-water atom.
 
# 126 # Note: No waters need moving
All water molecules are sufficiently close to the asymmetric unit given in
the input file.
 
# 127 # Note: Water hydrogen bonds OK
All water molecules can form hydrogen bonds.
 
# 128 # Error: His, Asn, Gln side chain flips
Listed here are Histidine, Asparagine or Glutamine residues for
which the orientation determined from hydrogen bonding analysis are
different from the assignment given in the input. Either they could
form energetically more favourable hydrogen bonds if the terminal
group was rotated by 180 degrees, or there is no assignment in the
input file (atom type 'A') but an assignment could be made. Be aware,
though, that if the topology could not be determined for one or more
ligands, then this option will make errors.
 
  206 HIS  ( 267-) D  -
  225 GLN  ( 286-) D  -
  262 ASN  ( 323-) D  -
  710 HIS  ( 267-) E  -
  729 GLN  ( 286-) E  -
  878 HIS  ( 267-) F  -
  897 GLN  ( 286-) F  -
  934 ASN  ( 323-) F  -
 
# 129 # Note: Histidine type assignments
For all complete HIS residues in the structure a tentative assignment to
HIS-D (protonated on ND1), HIS-E (protonated on NE2), or HIS-H (protonated
on both ND1 and NE2, positively charged) is made based on the hydrogen bond
network. A second assignment is made based on which of the Engh and Huber
[REF] histidine geometries fits best to the structure.
 
In the table below all normal histidine residues are listed. The assignment
based on the geometry of the residue is listed first, together with the RMS
Z-score for the fit to the Engh and Huber parameters. For all residues where
the H-bond assignment is different, the assignment is listed in the last
columns, together with its RMS Z-score to the Engh and Huber parameters.
 
As always, the RMS Z-scores should be close to 1.0 if the residues were
restrained to the Engh and Huber parameters during refinement, and if
enough (high resolution) data is available.
 
Please note that because the differences between the geometries of the
different types are small it is possible that the geometric assignment given
here does not correspond to the type used in refinement. This is especially
true if the RMS Z-scores are much higher than 1.0.
 
If the two assignments differ, or the `geometry' RMS Z-score is high, it is
advisable to verify the hydrogen bond assignment, check the HIS type used
during the refinement and possibly adjust it.
 
   38 HIS  ( 267-) A  -   HIS-E   0.67
   61 HIS  ( 290-) A  -   HIS-E   0.86
  206 HIS  ( 267-) D  -   HIS-E   0.84
  229 HIS  ( 290-) D  -   HIS-E   0.69
  374 HIS  ( 267-) B  -   HIS-E   0.50
  397 HIS  ( 290-) B  -   HIS-E   1.24
  542 HIS  ( 267-) C  -   HIS-E   0.76
  565 HIS  ( 290-) C  -   HIS-E   1.01
  710 HIS  ( 267-) E  -   HIS-E   0.66
  733 HIS  ( 290-) E  -   HIS-E   0.70
  878 HIS  ( 267-) F  -   HIS-E   1.06
  901 HIS  ( 290-) F  -   HIS-E   0.51
 
# 130 # Warning: Buried unsatisfied hydrogen bond donors
The buried hydrogen bond donors listed in the table below have a hydrogen
atom that is not involved in a hydrogen bond in the optimized hydrogen bond
network.
 
Hydrogen bond donors that are buried inside the protein normally use all of
their hydrogens to form hydrogen bonds within the protein. If there are any
non hydrogen bonded buried hydrogen bond donors in the structure they will
be listed here. In very good structures the number of listed atoms will tend
to zero.
 
Waters are not listed by this option.
 
   77 ILE  ( 306-) A  -    N
  126 TRP  ( 355-) A  -    NE1
  156 ASN  ( 385-) A  -    ND2
  190 TYR  ( 251-) D  -    N
  224 SER  ( 285-) D  -    N
  227 ASN  ( 288-) D  -    N
  245 ILE  ( 306-) D  -    N
  247 THR  ( 308-) D  -    N
  294 TRP  ( 355-) D  -    NE1
  324 ASN  ( 385-) D  -    ND2
  413 ILE  ( 306-) B  -    N
  442 GLN  ( 335-) B  -    N
  450 ASP  ( 343-) B  -    N
  492 ASN  ( 385-) B  -    ND2
  507 LYS  ( 221-) C  -    N
And so on for a total of    42 lines.
 
# 131 # Warning: Buried unsatisfied hydrogen bond acceptors
The buried side-chain hydrogen bond acceptors listed in the table below are
not involved in a hydrogen bond in the optimized hydrogen bond network.
 
Side-chain hydrogen bond acceptors buried inside the protein normally form
hydrogen bonds within the protein. If there are any not hydrogen bonded in
the optimized hydrogen bond network they will be listed here.
 
Waters are not listed by this option.
 
  180 GLU  ( 230-) D  -    OE1
  516 GLU  ( 230-) C  -    OE1
  684 GLU  ( 230-) E  -    OE1
  696 GLU  ( 253-) E  -    OE1
  863 GLN  ( 252-) F  -    OE1
  864 GLU  ( 253-) F  -    OE1
 
# 132 # Note: Some notes regarding these donors and acceptors
The donors and acceptors have been counted, also as function of their
accessibility. The buried donors and acceptors have been binned in five
categories ranging from not forming any hydrogen bond till forming a poor
till perfect hydrogen bond. Obviously, the buried donors and acceptors
with no or just a poor hydrogen bond should be a topic of concern. As every
protein contains more acceptors than donors, unsatisfied donors are more in
need of attention than unsatisfied acceptors.
 
Total number of donors: 1585
- of which buried: 712
Total number of acceptors: 1694
- of which buried: 605
Total number of donor+acceptors: 186
  (e.g. the Ser Ogamma that can donate and accept)
- of which buried: 27
Buried donors: 712
- without H-bond: 36
- essentially without H-bond: 0
- with only a very poor H-bond: 22
- with a poor H-bond: 13
- with a H-bond: 641
Buried acceptors: 605
- without H-bond: 132
- essentially without H-bond: 1
- with only a very poor H-bond: 11
- with a poor H-bond: 7
- with a H-bond: 454
 
# 133 # Note: Content of the PDB file as interpreted by WHAT CHECK
Content of the PDB file as interpreted by WHAT CHECK.
WHAT CHECK has read your PDB file, and stored it internally in what is called
'the soup'. The content of this soup is listed here. An extensive explanation
of all frequently used WHAT CHECK output formats can be found at
swift.cmbi.ru.nl. Look under output formats. A course on reading this
'Molecules' table is part of the WHAT CHECK website.
 
     1     1 (  219)    16 (  234) A Protein             /zata/tempdir/1sl...
     2    17 (  246)   168 (  397) A Protein             /zata/tempdir/1sl...
     3   169 (  219)   187 (  237) D Protein             /zata/tempdir/1sl...
     4   188 (  249)   336 (  397) D Protein             /zata/tempdir/1sl...
     5   337 (  219)   352 (  234) B Protein             /zata/tempdir/1sl...
     6   353 (  246)   504 (  397) B Protein             /zata/tempdir/1sl...
     7   505 (  219)   520 (  234) C Protein             /zata/tempdir/1sl...
     8   521 (  246)   672 (  397) C Protein             /zata/tempdir/1sl...
     9   673 (  219)   691 (  237) E Protein             /zata/tempdir/1sl...
    10   692 (  249)   840 (  397) E Protein             /zata/tempdir/1sl...
    11   841 (  219)   859 (  237) F Protein             /zata/tempdir/1sl...
    12   860 (  249)  1008 (  397) F Protein             /zata/tempdir/1sl...
    13  1009 (    2)  1009 (    2) G Sugar               /zata/tempdir/1sl...
    14  1010 (    2)  1010 (    2) H Sugar               /zata/tempdir/1sl...
    15  1011 (    2)  1011 (    2) I Sugar               /zata/tempdir/1sl...
And so on for a total of    60 lines.
 
# 134 # Note: Summary report
This is an overall summary of the quality of the structure as compared with
current reliable structures. Numbers in brackets are the average and standard
deviation observed for a large number of files determined with a similar
resolution.
 
The second table mostly gives an impression of how well the model conforms
to common refinement restraint values. These numbers are less than 1.0 if the
spread in data is too little, and larger than 1.0 when the spread is too
large. The former does not need to be a problem, the latter always is bad.
 
 Structure Z-scores, positive is better than average:
  Resolution read from PDB file  :   2.250
  1st generation packing quality :   0.596 (          (  -0.3,  2.5))
  2nd generation packing quality :  -1.031 (          (  -1.2,  1.3))
  Ramachandran plot appearance   :  -1.866 (          (  -1.8,  1.3))
  chi-1/chi-2 rotamer normality  :  -1.843 (          (  -3.5,  1.6))
  Backbone conformation          :  -0.664 (          (  -0.7,  3.5))
  Inside/Outside distribution    :   1.094
 
 RMS Z-scores, should be close to 1.0:
  Bond lengths                   :   0.571 (tight)
  Bond angles                    :   0.763
  Omega angle restraints         :   1.053
  Side chain planarity           :   1.175
  Improper dihedral distribution :   0.763
  B-factor distribution          :   0.923
 
# 135 # Note: Introduction to refinement recommendations
First, be aware that the recommendations for crystallographers listed below
are produced by a computer program that was written by a guy who got his
PhD in NMR...
 
We have tried to convert the messages written in this report into a small
set of things you can do with your refinement software to get a better
structure. The things you should do first are listed first. And in some
cases you should first fix that problem, then refine a bit further, and
then run WHAT CHECK again before looking at other problems. If, for example,
WHAT CHECK has found a problem with the SCALE and CRYST cards, then you must
first fix that problem, refine the structure a bit further, and run WHAT
CHECK again because errors in the SCALE and or CRYST card can lead to many
problems elsewhere in the validation process.
 
It is also important to keep in mind that WHAT CHECK is software and that it
occasionally totally misunderstands what is the cause of a problem. But, if
WHAT CHECK lists a problem there normally is a problem albeit that it not
always is the actual problem that gets listed.
 
# 136 # Note: Matthews coefficient problem
WHAT CHECK detected a Matthews coefficient problem. Most times this is an
administrative problem caused by typing the wrong cell multiplicity number
on the CRYST card (or not typing it at all). Occasionally it is caused by
typing the wrong space group on the CRYST card. You better fix this problem,
but normally this problem does not cause WHAT CHECK to give any erroneous
error messages further down in the report.
 
# 137 # Note: Cell parameter anomaly
WHAT CHECK has compared the observed bond lengths with the Engh and Huber
parameters, and has done this as function of the direction of the bond
relative to the cell axes. From this analysis it was concluded that the
cell dimensions are probably not entirely perfect. The problem is not very
big, so you do not need to fix this before you start dealing with the other
suggestions, but you better fix this.
 
If this problem is caused by refining with another set of target values
than the Engh and Huber values, then WHAT CHECK cannot help you because
systematic target value deviations can also cause this message to pop up.
 
# 138 # Error: Bumps in your structure
Upon analysing the bumps in your structure, WHAT CHECK got a bit
worried. Sometimes this means that you have forgotten to lower the
occupancy of overlapping ligands, residues, or water molecules. But,
whatever is the origin of this problem, you have to analyse it and
fix it.
 
# 139 # Note: His, Asn, Gln side chain flips.
His, Asn, and Gln have an asymmetry in their side chain that is hard to
detect unless you have data at much better than 1.0 Angstrom resolution.
WHAT CHECK thinks that your structure contains His, Asn, or Gln residues that
will make better hydrogen bonds when flipped around their chi-2, chi-2, or
chi-3 side chain torsion angle, respectively. You better
check these Asn, His, and Gln residues, and if you use a refinement program
that includes molecular dynamics, then you must (after the
flips were made) refine a bit further before running WHAT CHECK again.
 
# 140 # Warning: Troublesome residues
The residues listed in the table below need to be inspected
 
This table is a very rough attempt to sort the residues according to how
badly they need your attention. The idea is that when you sit in  in front
of the graphics screen and study the residues with the electron density
present that you improve the structure most by dealing with the top residues
in this list first.
 
  504 ARG  ( 397-) B  -     16.07
  672 ARG  ( 397-) C  -     15.99
  335 PHE  ( 396-) D  -     15.21
  839 PHE  ( 396-) E  -     15.09
 1007 PHE  ( 396-) F  -     15.09
  167 PHE  ( 396-) A  -     11.83
  610 GLN  ( 335-) C  -     11.70
  442 GLN  ( 335-) B  -     11.62
  575 ARG  ( 300-) C  -     11.42
  743 ARG  ( 300-) E  -     11.05
   71 ARG  ( 300-) A  -     11.04
  239 ARG  ( 300-) D  -     10.97
  503 PHE  ( 396-) B  -     10.94
  911 ARG  ( 300-) F  -     10.80
  351 GLN  ( 233-) B  -     10.70
And so on for a total of    74 lines.
==============
 
 
WHAT IF
    G.Vriend,
      WHAT IF: a molecular modelling and drug design program,
    J. Mol. Graph. 8, 52--56 (1990).
 
WHAT_CHECK (verification routines from WHAT IF)
    R.W.W.Hooft, G.Vriend, C.Sander and E.E.Abola,
      Errors in protein structures
    Nature 381, 272 (1996).
    (see also http://swift.cmbi.ru.nl/gv/whatcheck for a course and extra
    information)
 
PDB facilities
    Touw WG, Baakman C, Black J, te Beek TA, Krieger E, Joosten RP, Vriend G.
      A series of PDB-related databanks for everyday needs.
    Nucleic Acids Research D364-368 Database issue (2015).
 
Bond lengths and angles, protein residues
    R.Engh and R.Huber,
      Accurate bond and angle parameters for X-ray protein structure
      refinement,
    Acta Crystallogr. A47, 392--400 (1991) and
    R.Engh and R.Huber,
    International Tables for Crystallography (2001)
 
 
Bond lengths and angles, DNA/RNA
    G.Parkinson, J.Voitechovsky, L.Clowney, A.T.Bruenger and H.Berman,
      New parameters for the refinement of nucleic acid-containing structures
    Acta Crystallogr. D52, 57--64 (1996).
 
DSSP
    W.Kabsch and C.Sander,
      Dictionary of protein secondary structure: pattern
      recognition of hydrogen bond and geometrical features
    Biopolymers 22, 2577--2637 (1983).
 
Hydrogen bond networks
    R.W.W.Hooft, C.Sander and G.Vriend,
      Positioning hydrogen atoms by optimizing hydrogen bond networks in
      protein structures
    PROTEINS, 26, 363--376 (1996).
 
Matthews' Coefficient
    B.W.Matthews
      Solvent content of Protein Crystals
    J. Mol. Biol. 33, 491--497 (1968).
 
Peptide flips
    Touw WG, Joosten RP, Vriend G.
      Detection of trans-cis flips and peptide-plane flips in protein
      structures.
    Acta Crystallogr D Biological Crystallograhy 71, 1604-1614 (2015).
 
Protein side chain planarity
    R.W.W. Hooft, C. Sander and G. Vriend,
      Verification of protein structures: side-chain planarity
    J. Appl. Cryst. 29, 714--716 (1996).
 
Puckering parameters
    D.Cremer and J.A.Pople,
      A general definition of ring puckering coordinates
    J. Am. Chem. Soc. 97, 1354--1358 (1975).
 
Quality Control
    G.Vriend and C.Sander,
      Quality control of protein models: directional atomic
      contact analysis,
    J. Appl. Cryst. 26, 47--60 (1993).
 
Ramachandran plot
    G.N.Ramachandran, C.Ramakrishnan and V.Sasisekharan,
      Stereochemistry of Polypeptide Chain Conformations
    J. Mol. Biol. 7, 95--99 (1963).
    R.W.W. Hooft, C.Sander and G.Vriend,
      Objectively judging the quality of a protein structure from a
      Ramachandran plot
    CABIOS (1997), 13, 425--430.
 
Symmetry Checks
    R.W.W.Hooft, C.Sander and G.Vriend,
      Reconstruction of symmetry related molecules from protein
      data bank (PDB) files
    J. Appl. Cryst. 27, 1006--1009 (1994).
 
Tau angle
    W.G.Touw and G.Vriend
      On the complexity of Engh and Huber refinement restraints: the angle
      tau as example.
    Acta Crystallogr D 66, 1341--1350 (2010).
 
Ion Checks
    I.D.Brown and K.K.Wu,
      Empirical Parameters for Calculating Cation-Oxygen Bond Valences
    Acta Cryst. B32, 1957--1959 (1975).
 
    M.Nayal and E.Di Cera,
      Valence Screening of Water in Protein Crystals Reveals Potential Na+
      Binding Sites
    J.Mol.Biol. 256 228--234 (1996).
 
    P.Mueller, S.Koepke and G.M.Sheldrick,
      Is the bond-valence method able to identify metal atoms in protein
      structures?
    Acta Cryst. D 59 32--37 (2003).
 
Checking checks
    K.Wilson, C.Sander, R.W.W.Hooft, G.Vriend, et al.
      Who checks the checkers
    J.Mol.Biol. (1998) 276,417-436.
==============
 
 
WHAT IF
    G.Vriend,
      WHAT IF: a molecular modelling and drug design program,
    J. Mol. Graph. 8, 52--56 (1990).
 
WHAT_CHECK (verification routines from WHAT IF)
    R.W.W.Hooft, G.Vriend, C.Sander and E.E.Abola,
      Errors in protein structures
    Nature 381, 272 (1996).
    (see also http://swift.cmbi.ru.nl/gv/whatcheck for a course and extra
    information)
 
PDB facilities
    Touw WG, Baakman C, Black J, te Beek TA, Krieger E, Joosten RP, Vriend G.
      A series of PDB-related databanks for everyday needs.
    Nucleic Acids Research D364-368 Database issue (2015).
 
Bond lengths and angles, protein residues
    R.Engh and R.Huber,
      Accurate bond and angle parameters for X-ray protein structure
      refinement,
    Acta Crystallogr. A47, 392--400 (1991) and
    R.Engh and R.Huber,
    International Tables for Crystallography (2001)
 
 
Bond lengths and angles, DNA/RNA
    G.Parkinson, J.Voitechovsky, L.Clowney, A.T.Bruenger and H.Berman,
      New parameters for the refinement of nucleic acid-containing structures
    Acta Crystallogr. D52, 57--64 (1996).
 
DSSP
    W.Kabsch and C.Sander,
      Dictionary of protein secondary structure: pattern
      recognition of hydrogen bond and geometrical features
    Biopolymers 22, 2577--2637 (1983).
 
Hydrogen bond networks
    R.W.W.Hooft, C.Sander and G.Vriend,
      Positioning hydrogen atoms by optimizing hydrogen bond networks in
      protein structures
    PROTEINS, 26, 363--376 (1996).
 
Matthews' Coefficient
    B.W.Matthews
      Solvent content of Protein Crystals
    J. Mol. Biol. 33, 491--497 (1968).
 
Peptide flips
    Touw WG, Joosten RP, Vriend G.
      Detection of trans-cis flips and peptide-plane flips in protein
      structures.
    Acta Crystallogr D Biological Crystallograhy 71, 1604-1614 (2015).
 
Protein side chain planarity
    R.W.W. Hooft, C. Sander and G. Vriend,
      Verification of protein structures: side-chain planarity
    J. Appl. Cryst. 29, 714--716 (1996).
 
Puckering parameters
    D.Cremer and J.A.Pople,
      A general definition of ring puckering coordinates
    J. Am. Chem. Soc. 97, 1354--1358 (1975).
 
Quality Control
    G.Vriend and C.Sander,
      Quality control of protein models: directional atomic
      contact analysis,
    J. Appl. Cryst. 26, 47--60 (1993).
 
Ramachandran plot
    G.N.Ramachandran, C.Ramakrishnan and V.Sasisekharan,
      Stereochemistry of Polypeptide Chain Conformations
    J. Mol. Biol. 7, 95--99 (1963).
    R.W.W. Hooft, C.Sander and G.Vriend,
      Objectively judging the quality of a protein structure from a
      Ramachandran plot
    CABIOS (1997), 13, 425--430.
 
Symmetry Checks
    R.W.W.Hooft, C.Sander and G.Vriend,
      Reconstruction of symmetry related molecules from protein
      data bank (PDB) files
    J. Appl. Cryst. 27, 1006--1009 (1994).
 
Tau angle
    W.G.Touw and G.Vriend
      On the complexity of Engh and Huber refinement restraints: the angle
      tau as example.
    Acta Crystallogr D 66, 1341--1350 (2010).
 
Ion Checks
    I.D.Brown and K.K.Wu,
      Empirical Parameters for Calculating Cation-Oxygen Bond Valences
    Acta Cryst. B32, 1957--1959 (1975).
 
    M.Nayal and E.Di Cera,
      Valence Screening of Water in Protein Crystals Reveals Potential Na+
      Binding Sites
    J.Mol.Biol. 256 228--234 (1996).
 
    P.Mueller, S.Koepke and G.M.Sheldrick,
      Is the bond-valence method able to identify metal atoms in protein
      structures?
    Acta Cryst. D 59 32--37 (2003).
 
Checking checks
    K.Wilson, C.Sander, R.W.W.Hooft, G.Vriend, et al.
      Who checks the checkers
    J.Mol.Biol. (1998) 276,417-436.
